close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second102,323 (7.01%)100,571 (5.18%)99,628 (4.19%)98,906 (3.43%)98,871 (3.40%)98,419 (2.93%)96,820 (1.25%)96,632 (1.06%)96,444 (0.86%)95,627 (0.01%)95,622worldveinpurification protocolblood of the enemyfocusing irislucid dreamsunbound forcecrucible of flamelife-forcevisionsbaseripple in spacebaseMaximum: 103,054.2Upper quartile: 97,155.4Mean: 95,626.9Median: 95,458.0Lower quartile: 93,927.4Minimum: 89,349.1
Created with Highcharts 4.2.3 Priority Target/Boss Damage 20,723 (6.25%)20,296 (4.06%)20,204 (3.59%)20,174 (3.43%)20,139 (3.25%)20,033 (2.71%)20,001 (2.55%)19,819 (1.61%)19,791 (1.47%)19,507 (0.01%)19,505worldveinblood of the enemypurification protocolvisionsfocusing irisunbound forcelucid dreamscrucible of flamelife-forceripple in spacebase

Actions per Minute / DPS Variance Summary

base : 95627 dps, 19505 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
95626.9 95626.9 83.5 / 0.087% 8677.1 / 9.1% 14109.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 95627
Fury of Elune 5872 6.1% 5.3 61.15sec 332210 324617 Direct 891.6 1660 3315 1969 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 891.56 136.88 0.00 1.0235 0.3046 1755201.94 1755201.94 0.00 37267.02 324616.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 725.33 81.36% 1660.10 1457 1987 1662.05 1595 1815 1204115 1204115 0.00
crit 166.23 18.64% 3315.24 2915 3974 3318.41 3097 3726 551087 551087 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 287 (1145) 0.3% (1.2%) 7.9 33.57sec 43336 0 Direct 7.9 9125 18256 10853 18.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 0.0000 0.0000 85912.64 85912.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 81.08% 9125.24 8921 9813 9125.12 8921 9813 58570 58570 0.00
crit 1.50 18.92% 18256.37 17842 19626 14211.03 0 19626 27343 27343 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 858 0.9% 7.9 33.57sec 32483 0 Direct 55.4 3911 7821 4640 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 55.41 0.00 0.00 0.0000 0.0000 257139.15 257139.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.08 81.35% 3911.13 3823 4206 3910.96 3823 4206 176309 176309 0.00
crit 10.33 18.65% 7821.43 7646 8411 7812.15 0 8411 80830 80830 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11064 11.6% 82.9 3.54sec 40005 25166 Direct 580.4 4810 9638 5715 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.92 580.45 0.00 0.00 1.5897 0.0000 3317271.33 3317271.33 0.00 25165.54 25165.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.65 81.26% 4810.13 3345 24211 4814.64 4397 5385 2268761 2268761 0.00
crit 108.80 18.74% 9637.85 6689 48422 9647.22 7841 12329 1048511 1048511 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21107 22.1% 64.3 4.61sec 98307 90748 Direct 128.6 3475 6948 4123 18.6%  
Periodic 1494.9 3262 6522 3874 18.8% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.30 128.60 1494.94 1494.94 1.0833 1.3839 6321025.52 6321025.52 0.00 2955.84 90747.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.62 81.35% 3474.93 3280 4472 3476.58 3351 3633 363555 363555 0.00
crit 23.98 18.65% 6948.07 6559 8943 6951.01 6559 7624 166591 166591 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1214.6 81.24% 3262.30 2 4163 3263.97 3181 3400 3962258 3962258 0.00
crit 280.4 18.76% 6521.71 8 8327 6524.81 6318 6948 1828622 1828622 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1170 (4189) 1.2% (4.4%) 31.5 9.05sec 39757 45385 Direct 32.4 9069 18128 10745 18.5%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.53 32.42 0.00 0.00 0.8760 0.0000 348406.23 348406.23 0.00 45384.85 45384.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.42 81.49% 9069.09 7949 10838 9080.19 8488 9918 239593 239593 0.00
crit 6.00 18.51% 18127.70 15898 21676 18113.01 0 21676 108813 108813 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3019 3.2% 17.3 16.55sec 52369 0 Direct 121.0 7481 0 7481 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.28 120.99 0.00 0.00 0.0000 0.0000 905168.62 905168.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.99 100.00% 7480.95 5962 16257 7486.04 6072 10441 905169 905169 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starfall 29607 31.0% 39.5 7.61sec 224700 208825 Periodic 2465.2 3030 6058 3597 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.46 0.00 0.00 2465.18 1.0760 0.0000 8866483.91 8866483.91 0.00 208824.61 208824.61
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2003.9 81.29% 3030.02 2838 3869 3031.55 2949 3158 6071931 6071931 0.00
crit 461.3 18.71% 6058.48 5675 7738 6061.42 5867 6467 2794553 2794553 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 309 0.3% 1.4 268.66sec 65509 76209 Direct 1.2 62781 125337 74966 19.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.22 0.00 0.00 0.8602 0.0000 91450.84 91450.84 0.00 76209.03 76209.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.98 80.53% 62781.12 51347 69612 53481.84 0 69612 61672 61672 0.00
crit 0.24 19.47% 125336.95 102695 139223 28620.75 0 139223 29778 29778 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2949 3.0% 45.0 4.60sec 19394 0 Direct 45.0 16374 32760 19395 18.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.99 44.99 0.00 0.00 0.0000 0.0000 872514.64 872514.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.69 81.56% 16373.98 16021 17623 16373.18 16021 17623 600794 600794 0.00
crit 8.29 18.44% 32760.30 32042 35246 32755.36 32042 35246 271720 271720 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19385 20.3% 18.5 16.38sec 313959 299038 Direct 18.5 4439 8885 5261 18.5%  
Periodic 1507.6 3188 6372 3785 18.8% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.49 18.49 1507.64 1507.64 1.0499 1.3830 5804334.62 5804334.62 0.00 2758.00 299038.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.07 81.50% 4438.68 4112 5607 4441.30 4190 4815 66880 66880 0.00
crit 3.42 18.50% 8885.23 8225 11214 8683.97 0 11214 30386 30386 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1224.8 81.24% 3188.04 90 4065 3189.67 3103 3328 3904822 3904822 0.00
crit 282.8 18.76% 6372.50 179 8130 6375.30 6168 6737 1802246 1802246 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.10sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.87sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9079 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 264.5sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.30%
  • arcanic_pulsar_2:0.87%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.0sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.41% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.8sec 183.8sec 13.52% 19.14% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 44.9sec 23.79% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.1sec 61.1sec 13.91% 0.00% 83.4(83.4) 5.1

Buff details

  • buff initial source:base
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.00% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.91%
  • ignition_mages_fuse_2:3.85%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 47.1sec 36.5sec 9.37% 8.98% 0.1(0.1) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.91%
  • lunar_empowerment_2:1.87%
  • lunar_empowerment_3:0.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.3 65.5sec 34.8sec 46.55% 0.00% 3.3(45.8) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.35%
  • overwhelming_power_2:1.39%
  • overwhelming_power_3:1.42%
  • overwhelming_power_4:1.46%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.59%
  • overwhelming_power_8:1.63%
  • overwhelming_power_9:1.67%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.76%
  • overwhelming_power_12:1.82%
  • overwhelming_power_13:1.87%
  • overwhelming_power_14:1.92%
  • overwhelming_power_15:1.98%
  • overwhelming_power_16:2.03%
  • overwhelming_power_17:2.09%
  • overwhelming_power_18:2.15%
  • overwhelming_power_19:2.22%
  • overwhelming_power_20:2.29%
  • overwhelming_power_21:2.36%
  • overwhelming_power_22:2.43%
  • overwhelming_power_23:2.50%
  • overwhelming_power_24:2.57%
  • overwhelming_power_25:1.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.8 0.1 16.5sec 16.4sec 12.69% 52.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.65%
  • solar_empowerment_2:0.04%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.8 18.6 14.6sec 7.6sec 88.01% 0.00% 18.6(18.6) 20.1

Buff details

  • buff initial source:base
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.6sec 7.4sec 88.30% 85.56% 1.2(1.2) 11.5

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.94%
  • starlord_2:31.06%
  • starlord_3:24.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.2 1.1 61.5sec 46.0sec 23.41% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.41%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starfall Astral Power 39.5 1973.0 50.0 50.0 4494.0
starsurge Astral Power 1.4 55.8 40.0 40.0 1637.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.53 260.22 (13.06%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.35 208.38 (10.46%) 2.50 0.00 0.00%
sunfire Astral Power 18.49 55.46 (2.78%) 3.00 0.00 0.00%
moonfire Astral Power 64.30 192.89 (9.68%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.92 995.05 (49.95%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.17 (10.05%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.77
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.50 0.00 61.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data base Damage Per Second
Count 2851
Mean 95626.89
Minimum 89349.09
Maximum 103054.15
Spread ( max - min ) 13705.06
Range [ ( max - min ) / 2 * 100% ] 7.17%
Standard Deviation 2273.6323
5th Percentile 92178.97
95th Percentile 99674.56
( 95th Percentile - 5th Percentile ) 7495.60
Mean Distribution
Standard Deviation 42.5816
95.00% Confidence Intervall ( 95543.43 - 95710.35 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2172
0.1 Scale Factor Error with Delta=300 44130
0.05 Scale Factor Error with Delta=300 176517
0.01 Scale Factor Error with Delta=300 4412901
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 2851
Mean 19504.52
Minimum 17554.88
Maximum 22308.60
Spread ( max - min ) 4753.72
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 742.4933
5th Percentile 18368.45
95th Percentile 20787.86
( 95th Percentile - 5th Percentile ) 2419.41
Mean Distribution
Standard Deviation 13.9057
95.00% Confidence Intervall ( 19477.27 - 19531.78 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5567
0.1 Scale Factor Error with Delta=300 4707
0.05 Scale Factor Error with Delta=300 18825
0.01 Scale Factor Error with Delta=300 470619
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 2851
Mean 95626.89
Minimum 89349.09
Maximum 103054.15
Spread ( max - min ) 13705.06
Range [ ( max - min ) / 2 * 100% ] 7.17%
Damage
Sample Data base Damage
Count 2851
Mean 28624909.43
Minimum 22607095.02
Maximum 34468548.99
Spread ( max - min ) 11861453.97
Range [ ( max - min ) / 2 * 100% ] 20.72%
DTPS
Sample Data base Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.40 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.46 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.40 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.36 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.31 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.08 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 63.99 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.56 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.58 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.05 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKRQMQQKRQQQQQRRJKPKPPOPQQRKQQRQRKQPOPPPIPKRQQKQQQKOPPPQPQKQQRQKOQQQKPPPPQQOQKQQQKRGIPPPQKOPPQQKQRQRKQQPOPPPKPQQQQKQQORPKPPPQPRQKQQOQHEFIKPKPRQPRPRPRJKRKRQRQMKQQPRQQPPKOPPQQKQQRPKQOPPQGPQKRIQQKQRKOPQQQPPPRPKQQKQOQQQKQPPPPPQKOQRQQKQQRPPIKOPPPKQRQQKQQQOKPPPPQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.163 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.089 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.013 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.939 default P moonfire enemy5 31.0/100: 31% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:05.864 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:07.251 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:08.056 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, battle_potion_of_intellect
0:08.056 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect
0:08.056 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:08.812 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:09.567 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:10.323 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.079 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.832 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:12.825 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.579 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.532 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.285 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.038 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.794 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.548 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.304 default P moonfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.059 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.812 default P moonfire enemy3 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.568 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.322 default P moonfire enemy4 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.076 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.830 default P moonfire enemy7 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.584 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, ignition_mages_fuse(4)
0:24.339 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, ignition_mages_fuse(5)
0:25.094 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:25.849 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:26.666 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, ignition_mages_fuse(5)
0:27.421 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(2), starfall, ignition_mages_fuse(5)
0:28.359 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(2), starfall
0:29.505 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:30.404 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:31.159 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:32.469 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:33.779 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:35.089 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:36.397 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:37.709 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3)
0:38.464 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:39.338 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:39.338 default K starfall Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar
0:40.292 default P moonfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, starlord, starfall
0:41.218 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, starfall
0:42.420 default P moonfire enemy3 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall
0:43.589 default P moonfire enemy4 5.0/100: 5% astral_power arcanic_pulsar, starlord(2), starfall
0:44.757 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(2), starfall
0:45.925 default P moonfire enemy7 12.5/100: 13% astral_power arcanic_pulsar, starlord(2), starfall
0:47.094 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(2), starfall
0:48.845 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord(2), starfall
0:50.594 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
0:51.589 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord(2)
0:52.756 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(3), starfall
0:54.459 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord(3), starfall
0:56.161 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(25)
0:57.044 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24)
0:58.607 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(23)
0:59.495 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starfall, overwhelming_power(22)
1:00.639 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21)
1:02.308 default P moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(19)
1:03.431 default O sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(18)
1:04.557 default P moonfire enemy2 30.0/100: 30% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(17)
1:05.689 default P moonfire enemy5 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(16)
1:06.822 default P moonfire enemy6 37.5/100: 38% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(15)
1:07.962 default I fury_of_elune Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(14)
1:09.202 default P moonfire enemy7 47.0/100: 47% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, overwhelming_power(12)
1:10.353 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, overwhelming_power(11)
1:11.507 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, overwhelming_power(10)
1:12.466 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(9)
1:14.159 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(7)
1:15.866 default K starfall Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(25)
1:16.935 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(25)
1:18.493 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23)
1:20.060 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starfall, overwhelming_power(21)
1:21.779 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, starfall, overwhelming_power(20)
1:22.931 default O sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19)
1:24.054 default P moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17)
1:25.183 default P moonfire enemy4 19.5/100: 20% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16)
1:26.319 default P moonfire enemy7 23.5/100: 24% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(15)
1:27.456 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14)
1:29.169 default P moonfire enemy2 40.0/100: 40% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12)
1:30.322 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord, overwhelming_power(11)
1:32.052 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord, overwhelming_power(9)
1:33.216 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(8)
1:34.915 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(7)
1:36.623 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(5)
1:37.597 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4)
1:39.320 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(2), conch_of_dark_whispers
1:40.479 default O sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power, conch_of_dark_whispers
1:41.610 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
1:43.313 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
1:45.171 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
1:47.029 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
1:48.267 default P moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:49.471 default P moonfire enemy3 4.5/100: 5% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:50.674 default P moonfire enemy5 8.5/100: 9% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:51.877 default P moonfire enemy6 12.5/100: 13% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:53.079 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:54.880 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
1:56.681 default O sunfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord
1:57.882 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord
1:59.684 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starlord
2:00.888 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall
2:02.639 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord(2), starfall
2:04.389 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(2), starfall
2:06.139 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
2:07.307 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, solar_empowerment, starfall
2:08.361 default G use_items Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starfall
2:08.361 default I fury_of_elune Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starfall, ignition_mages_fuse
2:09.549 default P moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, fury_of_elune, starfall, ignition_mages_fuse
2:10.734 default P moonfire enemy3 24.0/100: 24% astral_power arcanic_pulsar, fury_of_elune, starfall, ignition_mages_fuse
2:11.921 default P moonfire enemy7 35.0/100: 35% astral_power arcanic_pulsar, fury_of_elune, starfall, ignition_mages_fuse
2:13.107 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, fury_of_elune, starfall, ignition_mages_fuse(2)
2:14.811 default K starfall Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, fury_of_elune, ignition_mages_fuse(2)
2:15.949 default O sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, ignition_mages_fuse(2)
2:17.053 default P moonfire enemy2 29.0/100: 29% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(3)
2:18.115 default P moonfire enemy6 33.0/100: 33% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(3)
2:19.178 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(3)
2:20.770 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(4)
2:22.299 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(4)
2:23.321 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(4)
2:24.808 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, ignition_mages_fuse(5)
2:25.623 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), ignition_mages_fuse(5)
2:26.955 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(24), ignition_mages_fuse(5)
2:27.711 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), ignition_mages_fuse(5)
2:28.605 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22)
2:30.177 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(20)
2:31.761 default P moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24)
2:32.802 default O sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23)
2:33.849 default P moonfire enemy4 40.5/100: 41% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22)
2:34.899 default P moonfire enemy7 44.0/100: 44% astral_power arcanic_pulsar, starfall, overwhelming_power(21)
2:36.047 default P moonfire enemy2 48.0/100: 48% astral_power arcanic_pulsar, overwhelming_power(19)
2:37.204 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, overwhelming_power(18)
2:38.363 default P moonfire enemy6 2.5/100: 3% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17)
2:39.494 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16)
2:41.192 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14)
2:42.904 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(13), conch_of_dark_whispers
2:44.623 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11), conch_of_dark_whispers
2:46.354 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord, overwhelming_power(9), conch_of_dark_whispers
2:47.518 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(8), conch_of_dark_whispers
2:49.218 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(6), conch_of_dark_whispers
2:50.929 default O sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
2:52.077 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
2:53.061 default P moonfire enemy4 48.0/100: 48% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
2:54.220 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power, conch_of_dark_whispers
2:55.385 default P moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
2:56.521 default P moonfire enemy5 6.5/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
2:57.657 default P moonfire enemy6 10.0/100: 10% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
2:58.896 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
3:00.751 default P moonfire enemy2 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, conch_of_dark_whispers
3:01.990 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, conch_of_dark_whispers
3:03.043 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
3:04.745 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
3:05.886 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22), conch_of_dark_whispers
3:07.550 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(20)
3:09.226 default O sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18)
3:10.351 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17)
3:12.046 default H celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, starlord, starfall, overwhelming_power(15)
3:13.036 default E potion Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, celestial_alignment, starlord, overwhelming_power(14)
3:13.036 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, celestial_alignment, starlord, overwhelming_power(14), battle_potion_of_intellect
3:13.036 default I fury_of_elune Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, overwhelming_power(14), battle_potion_of_intellect
3:13.941 default K starfall Fluffy_Pillow 90.5/100: 91% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, overwhelming_power(14), battle_potion_of_intellect
3:14.845 default P moonfire enemy4 46.0/100: 46% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(13), battle_potion_of_intellect
3:15.725 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(12), battle_potion_of_intellect
3:16.610 default P moonfire Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(11), battle_potion_of_intellect
3:17.473 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:18.340 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
3:19.447 default P moonfire enemy6 47.5/100: 48% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:20.319 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:21.195 default P moonfire enemy3 70.0/100: 70% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:22.077 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:22.959 default P moonfire enemy7 82.0/100: 82% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:23.843 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:24.667 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:24.667 default K starfall Fluffy_Pillow 94.0/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:25.569 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, starlord, starfall, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:26.533 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, celestial_alignment, starlord, starfall, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:27.498 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:28.438 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:29.854 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:30.804 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:32.015 default M sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:32.976 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), battle_potion_of_intellect
3:34.079 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(14), battle_potion_of_intellect
3:35.699 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(13), battle_potion_of_intellect
3:37.323 default P moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(11), battle_potion_of_intellect
3:38.416 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(10)
3:39.347 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(9)
3:40.995 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord(3), overwhelming_power(8)
3:42.648 default P moonfire enemy3 66.0/100: 66% astral_power arcanic_pulsar, starlord(3), overwhelming_power(6)
3:43.760 default P moonfire enemy6 70.0/100: 70% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(5)
3:44.874 default K starfall Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(4)
3:46.093 default O sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(2)
3:47.285 default P moonfire enemy5 28.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power
3:48.483 default P moonfire enemy7 32.0/100: 32% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:49.684 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:51.485 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:53.288 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, starlord, torrent_of_elements
3:54.491 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
3:56.242 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
3:57.991 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements
3:58.983 default P moonfire enemy2 48.0/100: 48% astral_power arcanic_pulsar, starlord(2), starfall
4:00.153 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(2), starfall
4:01.322 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
4:03.025 default O sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
4:04.160 default P moonfire enemy6 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
4:05.297 default P moonfire enemy4 23.5/100: 24% astral_power arcanic_pulsar, starfall, torrent_of_elements
4:06.535 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starfall, torrent_of_elements
4:08.392 default G use_items Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, torrent_of_elements
4:08.392 default P moonfire enemy5 40.5/100: 41% astral_power arcanic_pulsar, torrent_of_elements, ignition_mages_fuse
4:09.578 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, torrent_of_elements, ignition_mages_fuse
4:11.355 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, ignition_mages_fuse
4:12.542 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(2)
4:13.408 default I fury_of_elune Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(2)
4:14.432 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(2)
4:15.740 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(21), ignition_mages_fuse(2)
4:17.284 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(3)
4:18.284 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(3)
4:19.743 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(3)
4:20.576 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(4)
4:21.521 default O sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(4)
4:22.442 default P moonfire enemy3 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(14), ignition_mages_fuse(4)
4:23.367 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(4)
4:24.757 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(5)
4:26.103 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
4:27.457 default P moonfire enemy2 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(5)
4:28.364 default P moonfire enemy4 55.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(5)
4:29.272 default P moonfire enemy5 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7)
4:30.380 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6)
4:31.325 default P moonfire Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, starlord(3), overwhelming_power(5)
4:32.441 default K starfall Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, overwhelming_power(4)
4:33.661 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(3)
4:35.442 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power
4:37.238 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord, starfall
4:38.442 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall
4:40.194 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starlord(2), starfall
4:41.364 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall
4:43.115 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall
4:44.865 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall
4:46.616 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(2), conch_of_dark_whispers
4:47.785 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
4:49.487 default P moonfire enemy2 23.5/100: 24% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
4:50.621 default P moonfire enemy3 27.5/100: 28% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
4:51.757 default P moonfire enemy4 31.5/100: 32% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
4:52.892 default P moonfire enemy5 35.0/100: 35% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
4:54.131 default P moonfire enemy7 39.0/100: 39% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
4:55.372 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, conch_of_dark_whispers
4:57.226 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, conch_of_dark_whispers
4:58.464 default O sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
4:59.666 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:01.468 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
5:02.491 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall
5:04.024 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord, starfall
5:05.824 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord
5:07.027 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(2), starfall
5:08.777 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24)
5:10.383 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(22)
5:11.300 default P moonfire enemy7 44.5/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21)
5:12.384 default P moonfire enemy3 48.0/100: 48% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20)
5:13.471 default I fury_of_elune Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19)
5:14.562 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, fury_of_elune, starlord(2), overwhelming_power(18)
5:15.656 default O sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(17)
5:16.725 default P moonfire enemy2 22.0/100: 22% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(16)
5:17.797 default P moonfire enemy4 30.5/100: 31% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(15)
5:18.970 default P moonfire enemy5 39.5/100: 40% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(14)
5:20.147 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(12)
5:21.332 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(11)
5:23.064 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(9)
5:24.054 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, overwhelming_power(8)
5:25.542 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(7)
5:27.298 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(5)
5:28.478 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4)
5:30.202 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(2)
5:31.940 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power
5:33.686 default O sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
5:34.855 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
5:36.024 default P moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
5:37.161 default P moonfire enemy3 5.5/100: 6% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
5:38.298 default P moonfire enemy4 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
5:39.434 default P moonfire enemy6 13.0/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
5:40.570 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, starfall, torrent_of_elements
5:42.424 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starfall, torrent_of_elements

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 99628 dps, 20296 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
99627.8 99627.8 87.0 / 0.087% 9246.8 / 9.3% 14373.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.9 6.8 Astral Power 0.00% 51.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 99628
Fury of Elune 6071 6.1% 5.3 60.84sec 342150 338939 Direct 906.7 1659 3319 2001 20.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.30 906.70 140.67 0.00 1.0095 0.2976 1814680.73 1814680.73 0.00 38428.71 338939.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 719.86 79.39% 1659.48 1457 1987 1661.31 1582 1801 1194575 1194575 0.00
crit 186.85 20.61% 3318.93 2915 3974 3322.46 3113 3649 620105 620105 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 297 (1191) 0.3% (1.2%) 8.1 32.91sec 44011 0 Direct 8.1 9127 18269 10971 20.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 8.11 0.00 0.00 0.0000 0.0000 89001.61 89001.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 79.82% 9126.52 8921 9813 9129.00 8921 9813 59097 59097 0.00
crit 1.64 20.18% 18268.74 17842 19626 14731.59 0 19626 29905 29905 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 894 0.9% 8.1 32.91sec 33039 0 Direct 56.8 3912 7826 4720 20.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 56.79 0.00 0.00 0.0000 0.0000 268022.52 268022.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.06 79.36% 3911.74 3823 4206 3912.15 3823 4206 176273 176273 0.00
crit 11.72 20.64% 7826.43 7646 8411 7827.72 7646 8411 91749 91749 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11709 11.8% 86.4 3.41sec 40660 26254 Direct 604.5 4810 9644 5809 20.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.35 604.46 0.00 0.00 1.5487 0.0000 3511058.99 3511058.99 0.00 26254.44 26254.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 479.62 79.35% 4810.11 3345 24211 4814.18 4460 5325 2307018 2307018 0.00
crit 124.84 20.65% 9644.37 6689 48422 9654.62 7832 11715 1204041 1204041 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21943 22.0% 64.3 4.60sec 102255 96228 Direct 128.5 3472 6939 4174 20.3%  
Periodic 1533.8 3265 6522 3935 20.6% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.27 128.54 1533.84 1533.84 1.0626 1.3488 6571793.64 6571793.64 0.00 3074.97 96227.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.51 79.75% 3472.12 3280 4472 3473.63 3358 3632 355910 355910 0.00
crit 26.03 20.25% 6938.69 6559 8943 6942.14 6559 7467 180621 180621 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1218.3 79.43% 3264.50 2 4163 3266.09 3189 3396 3977003 3977003 0.00
crit 315.6 20.57% 6522.30 20 8327 6525.22 6315 6802 2058259 2058259 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1207 (4402) 1.2% (4.4%) 32.1 8.88sec 41016 47683 Direct 33.0 9061 18103 10897 20.3%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.10 32.99 0.00 0.00 0.8602 0.0000 359522.30 359522.30 0.00 47683.23 47683.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.29 79.69% 9061.43 7949 10838 9071.68 8532 9950 238239 238239 0.00
crit 6.70 20.31% 18103.09 15898 21676 18124.44 0 21676 121284 121284 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3194 3.2% 18.0 15.74sec 53290 0 Direct 125.7 7613 0 7613 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 125.75 0.00 0.00 0.0000 0.0000 957297.70 957297.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.75 100.00% 7612.56 5962 16257 7614.35 6072 9987 957298 957298 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starfall 30772 30.9% 40.4 7.43sec 228259 217106 Periodic 2522.7 3031 6060 3653 20.5% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.37 0.00 0.00 2522.68 1.0514 0.0000 9215715.92 9215715.92 0.00 217106.01 217106.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2004.8 79.47% 3031.31 2838 3869 3032.80 2957 3155 6076984 6076984 0.00
crit 517.9 20.53% 6060.35 5675 7738 6063.03 5895 6389 3138732 3138732 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 309 0.3% 1.4 264.55sec 65234 76455 Direct 1.2 62848 124682 74981 19.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.22 0.00 0.00 0.8539 0.0000 91593.34 91593.34 0.00 76455.21 76455.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.98 80.39% 62848.08 51347 69612 53687.10 0 69612 61725 61725 0.00
crit 0.24 19.61% 124682.02 102695 139223 29158.36 0 139223 29868 29868 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 3027 3.0% 45.5 4.52sec 19697 0 Direct 45.5 16384 32779 19699 20.2%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.46 45.46 0.00 0.00 0.0000 0.0000 895472.59 895472.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.27 79.79% 16384.05 16021 17623 16383.84 16021 17623 594269 594269 0.00
crit 9.19 20.21% 32778.87 32042 35246 32772.96 32042 35246 301204 301204 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 20203 20.3% 18.5 16.41sec 327668 319027 Direct 18.5 4445 8887 5353 20.4%  
Periodic 1547.3 3191 6375 3846 20.6% 695.4%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.46 18.46 1547.28 1547.28 1.0271 1.3478 6049396.33 6049396.33 0.00 2874.73 319027.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 79.55% 4445.10 4112 5607 4447.58 4187 4813 65286 65286 0.00
crit 3.77 20.45% 8886.89 8225 11214 8744.69 0 11214 33546 33546 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1229.0 79.43% 3190.81 23 4065 3192.37 3116 3318 3921364 3921364 0.00
crit 318.3 20.57% 6374.97 60 8130 6377.89 6193 6646 2029201 2029201 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.45sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8940 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 262.3sec 94.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:92.98%
  • arcanic_pulsar_2:1.20%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 190.6sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.11% 8.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 12.5 0.0 23.8sec 23.8sec 32.88% 0.00% 0.0(0.0) 12.2

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:32.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 10.1 472.1 30.6sec 0.6sec 73.08% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:1.48%
  • bloodsoaked_counter_2:1.52%
  • bloodsoaked_counter_3:1.61%
  • bloodsoaked_counter_4:1.63%
  • bloodsoaked_counter_5:1.61%
  • bloodsoaked_counter_6:1.56%
  • bloodsoaked_counter_7:1.55%
  • bloodsoaked_counter_8:1.53%
  • bloodsoaked_counter_9:1.48%
  • bloodsoaked_counter_10:10.22%
  • bloodsoaked_counter_11:1.82%
  • bloodsoaked_counter_12:1.84%
  • bloodsoaked_counter_13:1.86%
  • bloodsoaked_counter_14:1.88%
  • bloodsoaked_counter_15:1.84%
  • bloodsoaked_counter_16:1.81%
  • bloodsoaked_counter_17:1.81%
  • bloodsoaked_counter_18:1.77%
  • bloodsoaked_counter_19:1.78%
  • bloodsoaked_counter_20:1.73%
  • bloodsoaked_counter_21:1.74%
  • bloodsoaked_counter_22:1.74%
  • bloodsoaked_counter_23:1.69%
  • bloodsoaked_counter_24:1.72%
  • bloodsoaked_counter_25:1.70%
  • bloodsoaked_counter_26:1.65%
  • bloodsoaked_counter_27:1.65%
  • bloodsoaked_counter_28:1.66%
  • bloodsoaked_counter_29:1.63%
  • bloodsoaked_counter_30:1.62%
  • bloodsoaked_counter_31:1.61%
  • bloodsoaked_counter_32:1.59%
  • bloodsoaked_counter_33:1.59%
  • bloodsoaked_counter_34:1.56%
  • bloodsoaked_counter_35:1.57%
  • bloodsoaked_counter_36:1.53%
  • bloodsoaked_counter_37:1.54%
  • bloodsoaked_counter_38:1.50%
  • bloodsoaked_counter_39:1.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 2.0 0.0 182.5sec 182.5sec 13.52% 18.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.3sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 60.8sec 60.8sec 13.97% 0.00% 83.7(83.7) 5.2

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.01% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.5 1.6 45.4sec 35.9sec 9.17% 8.83% 0.1(0.1) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.82%
  • lunar_empowerment_2:1.81%
  • lunar_empowerment_3:0.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 65.2sec 34.2sec 47.47% 0.00% 3.4(47.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.36%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.60%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.79%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 18.4 0.1 15.8sec 15.8sec 12.70% 54.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.66%
  • solar_empowerment_2:0.04%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 19.8 20.6 15.4sec 7.4sec 89.51% 0.00% 20.6(20.6) 19.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:89.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 14.0 27.8 22.2sec 7.2sec 89.67% 87.00% 1.1(1.1) 11.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.79%
  • starlord_2:31.24%
  • starlord_3:25.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.6sec 45.6sec 23.71% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.71%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starfall Astral Power 40.4 2018.7 50.0 50.0 4565.2
starsurge Astral Power 1.4 56.2 40.0 40.0 1631.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 33.10 264.76 (12.99%) 8.00 0.04 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.92%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.71 209.28 (10.27%) 2.50 0.00 0.00%
sunfire Astral Power 18.46 55.38 (2.72%) 3.00 0.00 0.00%
moonfire Astral Power 64.27 192.80 (9.46%) 3.00 0.00 0.00%
lunar_strike Astral Power 86.36 1036.23 (50.83%) 12.00 0.03 0.00%
natures_balance Astral Power 400.35 200.17 (9.82%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.80 6.92
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.48 0.50 77.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data blood of the enemy Damage Per Second
Count 2851
Mean 99627.82
Minimum 92846.90
Maximum 108198.72
Spread ( max - min ) 15351.82
Range [ ( max - min ) / 2 * 100% ] 7.70%
Standard Deviation 2369.9395
5th Percentile 95968.61
95th Percentile 103712.57
( 95th Percentile - 5th Percentile ) 7743.96
Mean Distribution
Standard Deviation 44.3852
95.00% Confidence Intervall ( 99540.82 - 99714.81 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2174
0.1 Scale Factor Error with Delta=300 47947
0.05 Scale Factor Error with Delta=300 191787
0.01 Scale Factor Error with Delta=300 4794665
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 2851
Mean 20295.77
Minimum 18102.35
Maximum 22960.04
Spread ( max - min ) 4857.69
Range [ ( max - min ) / 2 * 100% ] 11.97%
Standard Deviation 770.2382
5th Percentile 19119.97
95th Percentile 21640.54
( 95th Percentile - 5th Percentile ) 2520.57
Mean Distribution
Standard Deviation 14.4254
95.00% Confidence Intervall ( 20267.50 - 20324.04 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5533
0.1 Scale Factor Error with Delta=300 5065
0.05 Scale Factor Error with Delta=300 20258
0.01 Scale Factor Error with Delta=300 506447
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 2851
Mean 99627.82
Minimum 92846.90
Maximum 108198.72
Spread ( max - min ) 15351.82
Range [ ( max - min ) / 2 * 100% ] 7.70%
Damage
Sample Data blood of the enemy Damage
Count 2851
Mean 29823555.67
Minimum 23365999.09
Maximum 36243593.26
Spread ( max - min ) 12877594.17
Range [ ( max - min ) / 2 * 100% ] 21.59%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.30 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.53 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 40.37 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.40 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.31 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.26 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.08 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.01 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 86.99 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 32.14 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.07 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKRQMPQQKRQQQQRQRJKKPPPOPQQPRKQQQRQKQOPPPIKPPQKQRQQKOQQPQKPQPPQQKOQQQKRPQPQQKOPPPRQQKQGIQPKPOQKPPPQQQKRQQQQKOQPRPQKPPPRQQKOQQQKPQPQPPHEFKIOPKRQRQRQKRKPRQRQKOPPPPRQQQQKQQKOPQPPPQKPRQQQKORQQQGIKPPPKPPRQORKQQQQKQQQPKPOPPRQQKRQQQKQOPPPPQPKRQQIQKOQQKPPPQQKPQRQOKRQQRQLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power bloodsoaked_counter, battle_potion_of_intellect
0:01.240 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, bloodsoaked_counter, battle_potion_of_intellect
0:02.165 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, bloodsoaked_counter, battle_potion_of_intellect
0:03.091 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, bloodsoaked_counter, battle_potion_of_intellect
0:04.017 default P moonfire enemy3 27.5/100: 28% astral_power bloodlust, starlord, starfall, bloodsoaked_counter, battle_potion_of_intellect
0:04.941 default P moonfire enemy4 31.0/100: 31% astral_power bloodlust, starlord, starfall, bloodsoaked_counter(3), battle_potion_of_intellect
0:05.867 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, bloodsoaked_counter(4), battle_potion_of_intellect
0:07.254 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, bloodsoaked_counter(6), battle_potion_of_intellect
0:08.061 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, bloodsoaked_counter(8), battle_potion_of_intellect
0:08.061 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, bloodsoaked_counter(8), battle_potion_of_intellect
0:08.061 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse
0:08.815 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse
0:09.569 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse
0:10.323 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, bloodsoaked_counter(16), battle_potion_of_intellect, ignition_mages_fuse
0:11.077 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(17), battle_potion_of_intellect, ignition_mages_fuse
0:11.831 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(21), battle_potion_of_intellect, ignition_mages_fuse
0:12.823 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.579 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(28), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.533 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(31), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.288 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(36), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.043 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, bloodsoaked_counter(38), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.799 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, bloodsoaked_counter(39), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.555 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.310 default P moonfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.065 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.818 default P moonfire enemy2 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.572 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.326 default P moonfire enemy3 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.079 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.832 default P moonfire enemy6 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.588 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, bloodsoaked, ignition_mages_fuse(4)
0:24.343 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, bloodsoaked, ignition_mages_fuse(5)
0:25.098 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, bloodsoaked_counter, ignition_mages_fuse(5)
0:25.851 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, bloodsoaked_counter(3), ignition_mages_fuse(5)
0:26.669 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, bloodsoaked_counter(5), ignition_mages_fuse(5)
0:27.424 default P moonfire enemy5 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, bloodsoaked_counter(9), ignition_mages_fuse(5)
0:28.179 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, bloodsoaked_counter(10)
0:29.326 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(10)
0:30.675 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(11)
0:31.574 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(13)
0:32.330 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, bloodsoaked_counter(14)
0:33.641 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, bloodsoaked_counter(16)
0:34.951 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, bloodsoaked_counter(20)
0:36.261 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, bloodsoaked_counter(25)
0:37.573 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(27)
0:38.328 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), starfall, bloodsoaked_counter(29)
0:39.444 default R solar_wrath Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, starlord(3), bloodsoaked_counter(31)
0:40.321 default J cancel_buff Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(25), bloodsoaked_counter(33)
0:40.321 default K starfall Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, overwhelming_power(25), bloodsoaked_counter(33)
0:41.194 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), bloodsoaked_counter(35)
0:42.297 default P moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), bloodsoaked_counter(10), bloodsoaked
0:43.304 default P moonfire enemy2 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), bloodsoaked_counter(10), bloodsoaked
0:44.312 default P moonfire enemy7 8.5/100: 9% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), bloodsoaked_counter(10), bloodsoaked
0:45.325 default O sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), bloodsoaked_counter(10), bloodsoaked
0:46.340 default P moonfire enemy4 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked
0:47.361 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), bloodsoaked_counter(10), bloodsoaked
0:48.891 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked
0:50.426 default P moonfire enemy3 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(15), bloodsoaked_counter(11)
0:51.532 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(14), bloodsoaked_counter(16)
0:52.476 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(18)
0:53.591 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(19)
0:55.220 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(22)
0:56.861 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(26)
0:58.508 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(30)
0:59.451 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(32)
1:01.115 default K starfall Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(4), bloodsoaked_counter(34)
1:02.334 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(37)
1:04.116 default O sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power, bloodsoaked_counter(39)
1:05.313 default P moonfire enemy2 37.5/100: 38% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked
1:06.431 default P moonfire enemy5 41.0/100: 41% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked
1:07.548 default P moonfire enemy4 45.0/100: 45% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked
1:08.664 default I fury_of_elune Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked
1:09.781 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, fury_of_elune, starlord, bloodsoaked
1:10.897 default P moonfire enemy7 10.0/100: 10% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, bloodsoaked
1:11.982 default P moonfire enemy3 18.5/100: 19% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, bloodsoaked
1:13.066 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, bloodsoaked_counter
1:14.816 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, bloodsoaked_counter(5)
1:15.986 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(25), bloodsoaked_counter(6)
1:17.542 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(23), bloodsoaked_counter(7)
1:18.432 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22), bloodsoaked_counter(8)
1:20.004 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(20), bloodsoaked_counter(10)
1:21.589 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, starfall, overwhelming_power(19), bloodsoaked_counter(15), conch_of_dark_whispers
1:22.743 default O sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), bloodsoaked_counter(20), conch_of_dark_whispers
1:23.845 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), bloodsoaked_counter(24), conch_of_dark_whispers
1:25.504 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(25), conch_of_dark_whispers
1:27.176 default P moonfire enemy7 40.0/100: 40% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(29), conch_of_dark_whispers
1:28.298 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(34), conch_of_dark_whispers
1:29.987 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:31.043 default P moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:32.076 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:33.626 default P moonfire enemy2 24.0/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:34.665 default P moonfire enemy5 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:35.710 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:37.275 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers
1:38.852 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(17), conch_of_dark_whispers
1:39.988 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(7), bloodsoaked_counter(17)
1:41.095 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(5), bloodsoaked_counter(19)
1:42.766 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starfall, overwhelming_power(4), bloodsoaked_counter(25)
1:44.594 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starfall, overwhelming_power(2), bloodsoaked_counter(29)
1:46.436 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starfall, bloodsoaked_counter(30)
1:47.674 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, bloodsoaked_counter(32)
1:48.696 default P moonfire enemy7 11.0/100: 11% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, bloodsoaked_counter(36)
1:49.898 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, bloodsoaked_counter(36)
1:51.429 default P moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(38)
1:52.631 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked
1:54.306 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked
1:55.979 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord, bloodsoaked
1:57.096 default O sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, bloodsoaked
1:58.183 default P moonfire enemy2 12.5/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, bloodsoaked
1:59.270 default P moonfire enemy3 16.5/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, bloodsoaked
2:00.355 default P moonfire enemy5 20.0/100: 20% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
2:01.524 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(2)
2:02.519 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, bloodsoaked_counter(4)
2:04.008 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), bloodsoaked_counter(6)
2:05.759 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2), bloodsoaked_counter(9)
2:06.929 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(13)
2:08.786 default G use_items Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(18)
2:08.786 default I fury_of_elune Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(18), ignition_mages_fuse
2:09.971 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, fury_of_elune, starfall, bloodsoaked_counter(19), ignition_mages_fuse
2:11.747 default P moonfire enemy7 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, starfall, bloodsoaked_counter(23), ignition_mages_fuse
2:12.935 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, fury_of_elune, starfall, bloodsoaked_counter(23), ignition_mages_fuse(2)
2:14.074 default P moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, bloodsoaked_counter(24), ignition_mages_fuse(2)
2:15.178 default O sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, bloodsoaked_counter(28), ignition_mages_fuse(2)
2:16.281 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, bloodsoaked_counter(30), ignition_mages_fuse(2)
2:17.937 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(25), bloodsoaked_counter(36), ignition_mages_fuse(3)
2:18.919 default P moonfire enemy2 2.5/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), bloodsoaked_counter(37), ignition_mages_fuse(3)
2:19.875 default P moonfire enemy3 6.0/100: 6% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), bloodsoaked, ignition_mages_fuse(3)
2:20.777 default P moonfire enemy5 9.5/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), bloodsoaked, ignition_mages_fuse(3)
2:21.682 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), bloodsoaked, ignition_mages_fuse(4)
2:22.994 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), bloodsoaked, ignition_mages_fuse(4)
2:24.313 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), bloodsoaked, ignition_mages_fuse(4)
2:25.639 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(17), bloodsoaked, ignition_mages_fuse(5)
2:26.499 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(16), bloodsoaked, ignition_mages_fuse(5)
2:27.252 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(15), bloodsoaked_counter, ignition_mages_fuse(5)
2:28.583 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24), bloodsoaked_counter(2), ignition_mages_fuse(5)
2:29.883 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23), bloodsoaked_counter(4)
2:31.450 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(21), bloodsoaked_counter(6)
2:33.029 default K starfall Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, starfall, overwhelming_power(19), bloodsoaked_counter(10)
2:34.185 default O sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18), bloodsoaked_counter(13)
2:35.312 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), bloodsoaked_counter(15)
2:37.005 default P moonfire enemy6 30.5/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(15), bloodsoaked_counter(16)
2:38.143 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(14), bloodsoaked_counter(16)
2:39.114 default P moonfire enemy2 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, overwhelming_power(13), bloodsoaked_counter(20)
2:40.260 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, overwhelming_power(12), bloodsoaked_counter(27)
2:41.729 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(11), bloodsoaked_counter(29)
2:42.884 default P moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(10), bloodsoaked_counter(33)
2:44.009 default P moonfire enemy4 14.0/100: 14% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(8), bloodsoaked_counter(33)
2:45.144 default P moonfire enemy7 18.0/100: 18% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(7), bloodsoaked_counter(39)
2:46.283 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(6), bloodsoaked
2:47.188 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(5), bloodsoaked
2:48.787 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4), bloodsoaked, conch_of_dark_whispers
2:50.392 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord(2), overwhelming_power(2), bloodsoaked, conch_of_dark_whispers
2:51.471 default O sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power, bloodsoaked, conch_of_dark_whispers
2:52.524 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, bloodsoaked, conch_of_dark_whispers
2:54.105 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starfall, bloodsoaked_counter, conch_of_dark_whispers
2:55.959 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(10), conch_of_dark_whispers
2:57.813 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(17), conch_of_dark_whispers
2:59.051 default P moonfire enemy6 1.0/100: 1% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(18), conch_of_dark_whispers
3:00.252 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(23), conch_of_dark_whispers
3:02.054 default P moonfire enemy2 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(26), conch_of_dark_whispers
3:03.256 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(34), conch_of_dark_whispers
3:05.058 default P moonfire enemy5 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked, conch_of_dark_whispers
3:06.173 default P moonfire enemy7 39.0/100: 39% astral_power arcanic_pulsar, starlord, bloodsoaked, conch_of_dark_whispers
3:07.290 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, starlord, bloodsoaked, conch_of_dark_whispers
3:08.263 default E potion Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, celestial_alignment, starlord, bloodsoaked, conch_of_dark_whispers
3:08.263 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, celestial_alignment, starlord, bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:08.263 default K starfall Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:09.144 default I fury_of_elune Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:10.003 default O sunfire Fluffy_Pillow 37.0/100: 37% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:10.797 default P moonfire enemy4 45.5/100: 46% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:11.590 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:12.386 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(22), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:13.163 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:14.410 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(20), bloodsoaked_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:15.247 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(19), bloodsoaked_counter(13), battle_potion_of_intellect
3:16.503 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(15), battle_potion_of_intellect
3:17.257 default Q lunar_strike Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(16), battle_potion_of_intellect
3:18.524 default K starfall Fluffy_Pillow 96.0/100: 96% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starfall, torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(18), battle_potion_of_intellect
3:19.449 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(18), battle_potion_of_intellect
3:20.216 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(23), battle_potion_of_intellect
3:21.120 default P moonfire enemy6 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(25), battle_potion_of_intellect
3:22.089 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(28), battle_potion_of_intellect
3:23.063 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(30), battle_potion_of_intellect
3:24.527 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(34), battle_potion_of_intellect
3:25.508 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(37), battle_potion_of_intellect
3:26.981 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(8), bloodsoaked, battle_potion_of_intellect
3:27.901 default O sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(7), bloodsoaked, battle_potion_of_intellect
3:28.932 default P moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(24), bloodsoaked, battle_potion_of_intellect
3:29.906 default P moonfire enemy2 10.5/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(23), bloodsoaked, battle_potion_of_intellect
3:30.883 default P moonfire enemy3 14.5/100: 14% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(22), bloodsoaked, battle_potion_of_intellect
3:31.866 default P moonfire enemy4 18.0/100: 18% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(21), bloodsoaked, battle_potion_of_intellect
3:32.851 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(20), bloodsoaked, battle_potion_of_intellect
3:33.690 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(19), bloodsoaked
3:35.176 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(2)
3:36.777 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(4)
3:38.383 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(10)
3:40.000 default K starfall Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(13)
3:41.185 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(14)
3:42.915 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(17)
3:44.652 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(20)
3:45.821 default O sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(21)
3:46.891 default P moonfire enemy5 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(26)
3:47.963 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), bloodsoaked_counter(26)
3:49.576 default P moonfire enemy3 31.0/100: 31% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), bloodsoaked_counter(28)
3:50.659 default P moonfire enemy2 34.5/100: 35% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), bloodsoaked_counter(31)
3:51.747 default P moonfire enemy4 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19), bloodsoaked_counter(31)
3:52.839 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), overwhelming_power(18), bloodsoaked_counter(32)
3:54.481 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(16), bloodsoaked_counter(35)
3:55.583 default P moonfire enemy7 6.0/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(15), bloodsoaked_counter(38)
3:56.661 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(14), bloodsoaked_counter(38)
3:57.578 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall, overwhelming_power(13), bloodsoaked_counter(39)
3:58.960 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(12), bloodsoaked_counter(39)
4:00.589 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starfall, overwhelming_power(10), bloodsoaked
4:02.254 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(8), bloodsoaked
4:03.373 default O sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(7), bloodsoaked
4:04.463 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(6), bloodsoaked
4:05.394 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, overwhelming_power(5), bloodsoaked
4:06.793 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(4), bloodsoaked
4:08.444 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(2), bloodsoaked_counter(2)
4:10.234 default G use_items Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, bloodsoaked_counter(6)
4:10.234 default I fury_of_elune Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, bloodsoaked_counter(6), ignition_mages_fuse
4:11.385 default K starfall Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, bloodsoaked_counter(7), ignition_mages_fuse
4:12.537 default P moonfire enemy2 21.0/100: 21% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(13), ignition_mages_fuse
4:13.659 default P moonfire enemy3 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(15), ignition_mages_fuse
4:14.778 default P moonfire enemy4 41.0/100: 41% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(19), ignition_mages_fuse(2)
4:15.851 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, bloodsoaked_counter(19), ignition_mages_fuse(2)
4:16.925 default P moonfire enemy5 5.5/100: 6% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(24), ignition_mages_fuse(2)
4:17.969 default P moonfire enemy6 14.0/100: 14% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(28), ignition_mages_fuse(2)
4:19.013 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(29), ignition_mages_fuse(3)
4:19.867 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(3), starfall, bloodsoaked_counter(30), ignition_mages_fuse(3)
4:21.370 default O sunfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, bloodsoaked_counter(34), ignition_mages_fuse(3)
4:22.374 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment, starfall, bloodsoaked_counter(37), ignition_mages_fuse(4)
4:23.266 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, starfall, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(4)
4:24.254 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(4)
4:25.693 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(4)
4:27.130 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(5)
4:28.521 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(5)
4:29.912 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(5)
4:30.839 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
4:32.466 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, bloodsoaked_counter(12), conch_of_dark_whispers
4:34.215 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, bloodsoaked_counter(18), conch_of_dark_whispers
4:35.966 default P moonfire enemy6 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, bloodsoaked_counter(22), conch_of_dark_whispers
4:37.134 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, bloodsoaked_counter(25), conch_of_dark_whispers
4:38.303 default P moonfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, bloodsoaked_counter(30), conch_of_dark_whispers
4:39.438 default O sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, bloodsoaked_counter(30), conch_of_dark_whispers
4:40.575 default P moonfire enemy3 9.0/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, bloodsoaked_counter(38), conch_of_dark_whispers
4:41.710 default P moonfire enemy7 12.5/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, bloodsoaked, conch_of_dark_whispers
4:42.768 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, bloodsoaked, conch_of_dark_whispers
4:43.667 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starfall, torrent_of_elements, bloodsoaked, conch_of_dark_whispers
4:45.390 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, torrent_of_elements, bloodsoaked, conch_of_dark_whispers
4:47.115 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, bloodsoaked
4:48.265 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, bloodsoaked
4:49.217 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
4:50.749 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(3)
4:52.549 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, bloodsoaked_counter(5)
4:54.351 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, starfall, bloodsoaked_counter(8)
4:55.552 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(12)
4:57.302 default O sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(18)
4:58.470 default P moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(23)
4:59.637 default P moonfire enemy4 21.5/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(27)
5:00.805 default P moonfire enemy5 25.5/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(28)
5:01.975 default P moonfire enemy7 29.0/100: 29% astral_power arcanic_pulsar, starlord(2), starfall, bloodsoaked_counter(28)
5:03.144 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(2), bloodsoaked_counter(32)
5:04.896 default P moonfire enemy2 46.0/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord(2), bloodsoaked_counter(37)
5:06.065 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(2), bloodsoaked_counter(10), bloodsoaked
5:07.150 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(24), bloodsoaked_counter(10), bloodsoaked
5:08.053 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starfall, overwhelming_power(23), bloodsoaked_counter(10), bloodsoaked
5:09.650 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starfall, overwhelming_power(22), bloodsoaked_counter(10), bloodsoaked
5:11.251 default I fury_of_elune Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starfall, overwhelming_power(20), bloodsoaked_counter(10), bloodsoaked
5:12.327 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked
5:13.944 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(18), bloodsoaked_counter(11)
5:15.103 default O sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(16), bloodsoaked_counter(16)
5:16.239 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(15), bloodsoaked_counter(17)
5:17.945 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(14), bloodsoaked_counter(23)
5:19.657 default K starfall Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12), bloodsoaked_counter(27)
5:20.807 default P moonfire enemy5 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), bloodsoaked_counter(30)
5:21.930 default P moonfire enemy3 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), bloodsoaked_counter(31)
5:23.003 default P moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), bloodsoaked_counter(31)
5:24.083 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), bloodsoaked_counter(33)
5:25.707 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), bloodsoaked_counter(36)
5:27.335 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), bloodsoaked
5:28.356 default P moonfire enemy4 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(17), bloodsoaked
5:29.353 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(16), bloodsoaked
5:30.851 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(15), bloodsoaked
5:31.705 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall, overwhelming_power(14), bloodsoaked
5:32.988 default O sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(13), bloodsoaked
5:33.998 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(12), bloodsoaked
5:35.102 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(10), bloodsoaked
5:36.018 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9), bloodsoaked_counter(3)
5:37.760 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(8), bloodsoaked_counter(5)
5:39.509 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(6), bloodsoaked_counter(10)
5:40.509 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(5), bloodsoaked_counter(14)
5:42.275 default L starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord, overwhelming_power(3), bloodsoaked_counter(18)
5:43.463 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(2), bloodsoaked_counter(23)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

crucible of flame : 96820 dps, 19819 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
96819.5 96819.5 84.4 / 0.087% 8742.7 / 9.0% 14287.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 96820
Ancient Flame 1163 1.2% 24.1 12.06sec 14455 0 Periodic 109.5 2680 5374 3184 18.7% 72.0%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.12 0.00 109.49 109.49 0.0000 1.9715 348650.69 348650.69 0.00 1615.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.0 81.29% 2680.36 2 7186 2673.92 2181 3959 238550 238550 0.00
crit 20.5 18.71% 5374.02 24 14373 5354.10 3492 8624 110101 110101 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1582.83
  • base_td_mult:1.25
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fury of Elune 5865 6.0% 5.3 61.13sec 332100 324572 Direct 891.5 1660 3314 1967 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 891.47 136.86 0.00 1.0233 0.3046 1753337.77 1753337.77 0.00 37235.34 324571.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 726.04 81.44% 1659.85 1457 1987 1661.74 1591 1798 1205081 1205081 0.00
crit 165.44 18.56% 3314.03 2915 3974 3317.38 3103 3712 548257 548257 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 288 (1155) 0.3% (1.2%) 8.0 33.90sec 43370 0 Direct 8.0 9131 18248 10822 18.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.98 7.98 0.00 0.00 0.0000 0.0000 86328.48 86328.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 81.48% 9130.67 8921 9813 9128.55 0 9813 59357 59357 0.00
crit 1.48 18.52% 18247.64 17842 19626 14051.91 0 19626 26972 26972 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 867 0.9% 8.0 33.90sec 32551 0 Direct 55.9 3913 7826 4650 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.98 55.85 0.00 0.00 0.0000 0.0000 259720.86 259720.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.33 81.15% 3912.50 3823 4206 3913.12 3823 4206 177335 177335 0.00
crit 10.53 18.85% 7826.05 7646 8411 7824.01 0 8411 82385 82385 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11064 11.4% 82.9 3.55sec 40034 25188 Direct 580.1 4816 9637 5719 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.88 580.15 0.00 0.00 1.5894 0.0000 3317916.68 3317916.68 0.00 25188.02 25188.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.52 81.28% 4816.27 3345 24211 4820.92 4426 5446 2270939 2270939 0.00
crit 108.63 18.72% 9637.06 6689 48422 9643.20 7768 11913 1046977 1046977 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21098 21.8% 64.3 4.60sec 98325 90801 Direct 128.5 3476 6948 4124 18.7%  
Periodic 1495.0 3263 6522 3872 18.7% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.26 128.52 1494.96 1494.96 1.0829 1.3839 6318503.03 6318503.03 0.00 2954.77 90801.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.52 81.32% 3475.57 3280 4472 3477.06 3369 3660 363267 363267 0.00
crit 24.00 18.68% 6948.49 6559 8943 6952.60 6559 7651 166791 166791 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1215.6 81.31% 3262.91 2 4163 3264.52 3185 3401 3966358 3966358 0.00
crit 279.4 18.69% 6522.29 10 8327 6525.13 6293 6845 1822087 1822087 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1174 (4221) 1.2% (4.4%) 31.7 8.98sec 39889 45505 Direct 32.5 9066 18123 10745 18.5%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.66 32.55 0.00 0.00 0.8766 0.0000 349708.21 349708.21 0.00 45504.91 45504.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.51 81.47% 9066.14 7949 10838 9076.43 8623 9991 240383 240383 0.00
crit 6.03 18.53% 18122.73 15898 21676 18108.17 0 21676 109325 109325 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3046 3.2% 17.4 16.28sec 52420 0 Direct 122.0 7488 0 7488 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.42 121.97 0.00 0.00 0.0000 0.0000 913371.61 913371.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.97 100.00% 7488.46 5962 16257 7490.10 6093 9991 913372 913372 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11923.38
  • base_dd_max:11923.38
  • base_dd_mult:1.00
 
Starfall 29607 30.6% 39.5 7.60sec 224629 208738 Periodic 2465.8 3031 6058 3596 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.48 0.00 0.00 2465.82 1.0761 0.0000 8867616.93 8867616.93 0.00 208738.22 208738.22
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2005.1 81.32% 3030.53 2838 3869 3031.96 2961 3162 6076478 6076478 0.00
crit 460.7 18.68% 6058.32 5675 7738 6060.93 5882 6376 2791139 2791139 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 308 0.3% 1.4 264.79sec 66529 77837 Direct 1.2 62850 125393 74780 19.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.37 1.22 0.00 0.00 0.8554 0.0000 91147.18 91147.18 0.00 77837.05 77837.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.99 80.89% 62850.06 51347 69612 53742.32 0 69612 61943 61943 0.00
crit 0.23 19.11% 125392.81 102695 139223 27883.06 0 139223 29204 29204 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2956 3.0% 45.0 4.60sec 19431 0 Direct 45.0 16376 32761 19433 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 45.00 0.00 0.00 0.0000 0.0000 874405.56 874405.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.61 81.35% 16375.92 16021 17623 16375.75 16021 17534 599489 599489 0.00
crit 8.39 18.65% 32761.00 32042 35246 32757.26 32042 35246 274917 274917 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19382 20.0% 18.5 16.40sec 313861 298966 Direct 18.5 4441 8880 5284 19.0%  
Periodic 1507.7 3189 6374 3785 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.49 18.49 1507.67 1507.67 1.0499 1.3830 5803835.84 5803835.84 0.00 2757.86 298966.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.98 81.02% 4441.47 4112 5607 4443.36 4137 4783 66543 66543 0.00
crit 3.51 18.98% 8880.07 8225 11214 8691.76 0 11214 31163 31163 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1225.5 81.28% 3188.52 29 4065 3190.06 3113 3322 3907364 3907364 0.00
crit 282.2 18.72% 6373.80 59 8130 6376.60 6181 6668 1798765 1798765 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 183.97sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.75sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9079 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 264.6sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.39%
  • arcanic_pulsar_2:0.79%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.1sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.9sec 183.9sec 13.52% 19.14% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.4sec 45.4sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.2sec 61.2sec 13.91% 0.00% 83.4(83.4) 5.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.00% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.91%
  • ignition_mages_fuse_2:3.85%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 46.8sec 36.5sec 9.47% 9.09% 0.1(0.1) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:7.02%
  • lunar_empowerment_2:1.86%
  • lunar_empowerment_3:0.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.3 65.5sec 34.9sec 46.53% 0.00% 3.3(45.9) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.35%
  • overwhelming_power_2:1.39%
  • overwhelming_power_3:1.42%
  • overwhelming_power_4:1.46%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.62%
  • overwhelming_power_9:1.67%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.76%
  • overwhelming_power_12:1.82%
  • overwhelming_power_13:1.87%
  • overwhelming_power_14:1.92%
  • overwhelming_power_15:1.97%
  • overwhelming_power_16:2.04%
  • overwhelming_power_17:2.10%
  • overwhelming_power_18:2.16%
  • overwhelming_power_19:2.22%
  • overwhelming_power_20:2.29%
  • overwhelming_power_21:2.36%
  • overwhelming_power_22:2.43%
  • overwhelming_power_23:2.50%
  • overwhelming_power_24:2.57%
  • overwhelming_power_25:1.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.9 0.1 16.3sec 16.2sec 12.74% 53.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.69%
  • solar_empowerment_2:0.05%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.8 18.7 14.6sec 7.6sec 88.03% 0.00% 18.7(18.7) 20.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.6sec 7.4sec 88.25% 85.55% 1.2(1.2) 11.5

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.89%
  • starlord_2:31.00%
  • starlord_3:24.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.3sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.56%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starfall Astral Power 39.5 1973.8 50.0 50.0 4492.6
starsurge Astral Power 1.4 54.8 40.0 40.0 1663.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.66 261.28 (13.11%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.01%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.34 208.36 (10.46%) 2.50 0.00 0.00%
sunfire Astral Power 18.49 55.47 (2.78%) 3.00 0.00 0.00%
moonfire Astral Power 64.26 192.78 (9.67%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.88 994.54 (49.91%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.17 (10.05%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.76
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.72 0.50 61.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data crucible of flame Damage Per Second
Count 2851
Mean 96819.52
Minimum 90142.79
Maximum 104749.80
Spread ( max - min ) 14607.01
Range [ ( max - min ) / 2 * 100% ] 7.54%
Standard Deviation 2300.4216
5th Percentile 93290.81
95th Percentile 100764.73
( 95th Percentile - 5th Percentile ) 7473.92
Mean Distribution
Standard Deviation 43.0833
95.00% Confidence Intervall ( 96735.08 - 96903.96 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2169
0.1 Scale Factor Error with Delta=300 45176
0.05 Scale Factor Error with Delta=300 180701
0.01 Scale Factor Error with Delta=300 4517504
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 2851
Mean 19818.97
Minimum 17522.64
Maximum 22688.17
Spread ( max - min ) 5165.53
Range [ ( max - min ) / 2 * 100% ] 13.03%
Standard Deviation 773.1356
5th Percentile 18657.03
95th Percentile 21142.67
( 95th Percentile - 5th Percentile ) 2485.64
Mean Distribution
Standard Deviation 14.4796
95.00% Confidence Intervall ( 19790.59 - 19847.35 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5846
0.1 Scale Factor Error with Delta=300 5103
0.05 Scale Factor Error with Delta=300 20411
0.01 Scale Factor Error with Delta=300 510265
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 2851
Mean 96819.52
Minimum 90142.79
Maximum 104749.80
Spread ( max - min ) 14607.01
Range [ ( max - min ) / 2 * 100% ] 7.54%
Damage
Sample Data crucible of flame Damage
Count 2851
Mean 28984542.85
Minimum 22521501.29
Maximum 35258844.46
Spread ( max - min ) 12737343.17
Range [ ( max - min ) / 2 * 100% ] 21.97%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.39 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.48 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.37 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.36 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.30 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.07 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 63.96 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.54 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.72 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.06 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRQQQKRQQQOQQQJKPPKPPQQQKORQRQQKPPPPQIOKQQKQQRQKPPPPOPQQKQQQKQQOPPPPPKRQQQKQQOQGQIKPPPPKQRQKOQQQRKQPPQPPPPKORQQQKQQRPQKPOPPPRQQKQQQHEFKIOKPRPRPRPRPRKRKRQMQQKPQPPPQQKQQOQKRQQPRKPPPGPQOQKRQIQKQQQKPPOPPPQKRQQQKQQOPPPPKPRQQRQKOQQRKPPPPPPIQKORQKRQQQKPPPPQOPQL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.161 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.085 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.010 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.933 default P moonfire enemy5 31.0/100: 31% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:05.858 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:07.244 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:08.050 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, battle_potion_of_intellect
0:08.050 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect
0:08.050 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:08.804 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:09.560 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:10.315 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.068 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.822 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:12.814 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.569 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.377 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.131 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.886 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.640 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.394 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.148 default P moonfire enemy7 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.903 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.657 default P moonfire enemy2 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.413 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.167 default P moonfire enemy3 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.923 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.679 default P moonfire enemy4 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.435 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, ignition_mages_fuse(4)
0:24.192 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, ignition_mages_fuse(5)
0:24.948 default P moonfire enemy5 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, ignition_mages_fuse(5)
0:25.703 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, ignition_mages_fuse(5)
0:26.458 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, ignition_mages_fuse(5)
0:27.274 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, ignition_mages_fuse(5)
0:28.214 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall
0:29.562 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:30.462 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:31.216 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:32.529 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:33.840 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:35.152 default O sunfire Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:36.027 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:37.337 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall
0:38.647 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:39.955 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:39.955 default K starfall Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar
0:40.908 default P moonfire enemy3 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, starlord, starfall
0:41.834 default P moonfire enemy6 49.5/100: 50% astral_power arcanic_pulsar, starlord, starfall
0:43.037 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord, starfall
0:44.239 default P moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall
0:45.409 default P moonfire enemy5 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall
0:46.578 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall
0:48.328 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall
0:50.079 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), starfall
0:51.831 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
0:52.998 default O sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:54.134 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:55.100 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord(3), starfall
0:56.801 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:57.768 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall
0:59.215 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord(3), starfall
1:00.918 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar
1:02.157 default P moonfire enemy6 13.0/100: 13% astral_power arcanic_pulsar, starlord, starfall
1:03.358 default P moonfire enemy3 17.0/100: 17% astral_power arcanic_pulsar, starlord, starfall
1:04.562 default P moonfire enemy4 21.0/100: 21% astral_power arcanic_pulsar, starlord, starfall
1:05.764 default P moonfire enemy5 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall
1:06.966 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord, starfall
1:08.768 default I fury_of_elune Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall
1:09.970 default O sunfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord
1:11.173 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord
1:12.376 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall
1:14.127 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall
1:15.879 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall
1:17.049 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(3), starfall
1:18.752 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(3), starfall
1:20.454 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
1:21.422 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, starfall
1:22.999 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starfall
1:24.236 default P moonfire enemy6 13.0/100: 13% astral_power arcanic_pulsar, starlord, starfall
1:25.438 default P moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starlord, starfall
1:26.642 default P moonfire enemy3 20.5/100: 21% astral_power arcanic_pulsar, starlord, starfall
1:27.845 default P moonfire enemy4 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall
1:29.047 default O sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord, starfall
1:30.250 default P moonfire enemy7 32.0/100: 32% astral_power arcanic_pulsar, starlord, starfall
1:31.453 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord
1:33.253 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord
1:35.054 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord
1:36.258 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall
1:38.009 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord(2), starfall
1:39.759 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall
1:41.510 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(2), starfall
1:42.678 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(3), starfall
1:44.381 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
1:46.236 default O sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
1:47.475 default P moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, conch_of_dark_whispers
1:48.714 default P moonfire enemy3 37.0/100: 37% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, conch_of_dark_whispers
1:49.953 default P moonfire enemy4 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, conch_of_dark_whispers
1:51.192 default P moonfire enemy5 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, conch_of_dark_whispers
1:52.430 default P moonfire enemy2 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, conch_of_dark_whispers
1:53.671 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
1:54.803 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
1:55.741 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
1:57.399 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
1:59.070 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(19)
2:00.754 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(18)
2:01.881 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(17)
2:03.527 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15)
2:05.183 default O sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13)
2:06.298 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12)
2:07.975 default G use_items Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11)
2:07.975 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), ignition_mages_fuse
2:09.590 default I fury_of_elune Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord(2), overwhelming_power(9), ignition_mages_fuse
2:10.675 default K starfall Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, fury_of_elune, starlord(2), overwhelming_power(8), ignition_mages_fuse
2:11.763 default P moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(7), ignition_mages_fuse
2:12.823 default P moonfire enemy4 28.5/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(6), ignition_mages_fuse(2)
2:13.846 default P moonfire enemy5 37.0/100: 37% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(5), ignition_mages_fuse(2)
2:14.965 default P moonfire enemy2 45.5/100: 46% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(4), ignition_mages_fuse(2)
2:16.086 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, fury_of_elune, starfall, overwhelming_power(2), ignition_mages_fuse(3)
2:17.172 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power, ignition_mages_fuse(3)
2:18.758 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, ignition_mages_fuse(3)
2:19.660 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(3)
2:21.249 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(4)
2:22.271 default O sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(4)
2:23.265 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(4)
2:24.753 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(5)
2:26.189 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(5)
2:27.625 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, ignition_mages_fuse(5)
2:28.439 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord(2), starfall
2:29.608 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(3), starfall
2:31.311 default P moonfire enemy4 15.5/100: 16% astral_power arcanic_pulsar, starlord(3), starfall
2:32.446 default P moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall
2:33.584 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(25)
2:35.141 default P moonfire enemy3 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(23)
2:36.188 default P moonfire enemy6 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(22)
2:37.332 default P moonfire enemy2 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(21)
2:38.480 default P moonfire enemy5 47.5/100: 48% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(20)
2:39.631 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(19)
2:40.787 default O sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(18)
2:41.912 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(17)
2:42.874 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16)
2:44.573 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14)
2:46.286 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12)
2:48.009 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, starlord, overwhelming_power(10)
2:49.167 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(9)
2:50.860 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(8)
2:52.558 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(6)
2:53.530 default P moonfire enemy4 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(5)
2:54.677 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4)
2:56.400 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(2), conch_of_dark_whispers
2:57.561 default P moonfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power, conch_of_dark_whispers
2:58.694 default O sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers
2:59.830 default P moonfire enemy2 14.5/100: 14% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
3:01.067 default P moonfire enemy6 18.5/100: 19% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
3:02.305 default P moonfire enemy7 22.5/100: 23% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
3:03.543 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
3:04.592 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, conch_of_dark_whispers
3:06.447 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, conch_of_dark_whispers
3:08.302 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, conch_of_dark_whispers
3:09.539 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:11.340 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord, starfall
3:13.141 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord, starfall
3:14.942 default H celestial_alignment Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, starfall
3:15.988 default E potion Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, starfall
3:15.988 default F berserking Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, starfall, battle_potion_of_intellect
3:15.988 default K starfall Fluffy_Pillow 92.5/100: 93% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, starfall, battle_potion_of_intellect
3:16.939 default I fury_of_elune Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:17.864 default O sunfire Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:18.787 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:19.711 default P moonfire enemy3 10.5/100: 11% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:20.612 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:21.377 default P moonfire enemy2 30.0/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:22.276 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:23.177 default P moonfire enemy4 52.0/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:24.078 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:24.977 default P moonfire enemy6 74.5/100: 75% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:25.878 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:26.775 default P moonfire enemy7 86.5/100: 87% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:27.675 default R solar_wrath Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:28.573 default K starfall Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar, celestial_alignment, conch_of_dark_whispers, battle_potion_of_intellect
3:29.651 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:30.697 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:31.744 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:32.761 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:34.056 default M sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:35.072 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, battle_potion_of_intellect
3:36.824 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord(2), starfall, battle_potion_of_intellect
3:38.575 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord(2), starfall, battle_potion_of_intellect
3:39.743 default P moonfire enemy4 11.0/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:40.879 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:42.581 default P moonfire enemy3 28.0/100: 28% astral_power arcanic_pulsar, starlord(3), starfall
3:43.718 default P moonfire enemy5 32.0/100: 32% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24)
3:44.762 default P moonfire enemy7 35.5/100: 36% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23)
3:45.808 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22)
3:47.382 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20)
3:48.967 default K starfall Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, overwhelming_power(19), conch_of_dark_whispers
3:50.124 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), conch_of_dark_whispers
3:51.817 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16), conch_of_dark_whispers
3:53.516 default O sunfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14), conch_of_dark_whispers
3:54.660 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(13), conch_of_dark_whispers
3:56.381 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(11), conch_of_dark_whispers
3:57.536 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
3:58.495 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
4:00.188 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
4:01.895 default P moonfire enemy6 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
4:03.038 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
4:04.019 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(3)
4:05.176 default P moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(2)
4:06.304 default P moonfire enemy2 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power
4:07.436 default P moonfire enemy5 15.5/100: 16% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
4:08.571 default G use_items Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
4:08.571 default P moonfire enemy7 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, ignition_mages_fuse
4:09.659 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starfall, torrent_of_elements, ignition_mages_fuse
4:11.434 default O sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starfall, torrent_of_elements, ignition_mages_fuse
4:12.620 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, torrent_of_elements, ignition_mages_fuse(2)
4:14.324 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, solar_empowerment, ignition_mages_fuse(2)
4:15.461 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, ignition_mages_fuse(2)
4:16.400 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, ignition_mages_fuse(2)
4:17.808 default I fury_of_elune Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord, starfall, ignition_mages_fuse(3)
4:18.870 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, ignition_mages_fuse(3)
4:20.459 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, ignition_mages_fuse(3)
4:21.520 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, ignition_mages_fuse(4)
4:23.007 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, ignition_mages_fuse(4)
4:24.495 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, ignition_mages_fuse(4)
4:25.984 default K starfall Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(5)
4:26.941 default P moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(5)
4:27.872 default P moonfire enemy3 23.5/100: 24% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(5)
4:28.802 default O sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(3), starfall
4:29.940 default P moonfire enemy2 30.5/100: 31% astral_power arcanic_pulsar, starlord(3), starfall
4:31.077 default P moonfire enemy4 34.5/100: 35% astral_power arcanic_pulsar, starlord(3), starfall
4:32.215 default P moonfire enemy6 38.0/100: 38% astral_power arcanic_pulsar, starlord(3), starfall
4:33.350 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(3), starfall
4:35.052 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment
4:36.290 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
4:37.310 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall
4:39.111 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord, starfall
4:40.913 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starlord, starfall
4:42.714 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, starlord, starfall
4:43.915 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord(2), starfall
4:45.666 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall
4:47.416 default O sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
4:48.585 default P moonfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
4:49.754 default P moonfire enemy4 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
4:50.922 default P moonfire enemy5 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
4:52.089 default P moonfire enemy7 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
4:53.258 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
4:54.426 default P moonfire enemy3 1.0/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
4:55.565 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, solar_empowerment, starfall
4:56.616 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starfall
4:58.470 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starfall
5:00.325 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starfall, conch_of_dark_whispers
5:01.378 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, conch_of_dark_whispers
5:03.232 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, conch_of_dark_whispers
5:04.471 default O sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:05.673 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:07.474 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:09.275 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, conch_of_dark_whispers
5:10.299 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:11.501 default P moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:12.669 default P moonfire enemy5 6.0/100: 6% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:13.838 default P moonfire enemy2 10.0/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:15.006 default P moonfire enemy6 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:16.177 default P moonfire enemy3 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:17.346 default P moonfire enemy7 21.5/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24)
5:18.417 default I fury_of_elune Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), overwhelming_power(23)
5:19.496 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, fury_of_elune, starlord(2), overwhelming_power(22)
5:21.113 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), overwhelming_power(20)
5:22.201 default O sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(3), starfall, overwhelming_power(19)
5:23.263 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starfall, overwhelming_power(18)
5:24.251 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starfall, overwhelming_power(17)
5:25.735 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starfall, overwhelming_power(16)
5:26.905 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(15)
5:27.873 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14)
5:29.585 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(25)
5:31.232 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23)
5:32.893 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22)
5:34.003 default P moonfire enemy5 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20)
5:35.091 default P moonfire enemy6 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19)
5:36.182 default P moonfire enemy4 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18)
5:37.275 default P moonfire enemy3 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17)
5:38.372 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16)
5:40.025 default O sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24)
5:41.098 default P moonfire enemy7 36.0/100: 36% astral_power arcanic_pulsar, starlord(2), overwhelming_power(23)
5:42.174 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord(2), overwhelming_power(22)
5:43.792 default L starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord(2), overwhelming_power(21)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 98906 dps, 20139 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
98906.4 98906.4 86.7 / 0.088% 9118.1 / 9.2% 14169.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.0 6.8 Astral Power 0.00% 52.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 98906
Fury of Elune 6044 6.1% 5.3 60.89sec 340735 339876 Direct 917.4 1661 3315 1969 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.30 917.44 142.01 0.00 1.0026 0.2949 1806099.51 1806099.51 0.00 38276.17 339875.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 746.88 81.41% 1661.11 1457 1987 1663.06 1589 1807 1240659 1240659 0.00
crit 170.55 18.59% 3315.30 2915 3974 3318.64 3085 3683 565441 565441 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 297 (1185) 0.3% (1.2%) 8.2 33.06sec 43380 0 Direct 8.2 9127 18260 10865 19.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.0000 0.0000 89090.47 89090.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.64 80.98% 9127.43 8921 9813 9123.90 0 9813 60609 60609 0.00
crit 1.56 19.02% 18259.91 17842 19626 14564.25 0 19626 28482 28482 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 888 0.9% 8.2 33.06sec 32515 0 Direct 57.4 3912 7824 4645 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 57.40 0.00 0.00 0.0000 0.0000 266624.52 266624.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.64 81.26% 3911.92 3823 4206 3912.18 3823 4206 182473 182473 0.00
crit 10.75 18.74% 7824.28 7646 8411 7821.43 0 8411 84151 84151 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11641 11.8% 87.3 3.37sec 40002 26002 Direct 610.8 4817 9609 5714 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.25 610.77 0.00 0.00 1.5385 0.0000 3490287.67 3490287.67 0.00 26001.52 26001.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 496.36 81.27% 4816.80 3345 24211 4821.71 4460 5332 2390920 2390920 0.00
crit 114.40 18.73% 9608.74 6689 48422 9619.75 7964 11936 1099367 1099367 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21767 22.0% 64.4 4.60sec 101300 96244 Direct 128.7 3471 6940 4120 18.7%  
Periodic 1545.9 3264 6524 3874 18.7% 690.0%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.35 128.70 1545.85 1545.85 1.0525 1.3387 6518794.88 6518794.88 0.00 3050.29 96243.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.66 81.32% 3471.42 3280 4472 3473.06 3359 3704 363324 363324 0.00
crit 24.04 18.68% 6940.36 6559 8943 6943.75 6559 7539 166860 166860 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1256.7 81.30% 3264.27 2 4163 3265.91 3182 3430 4102350 4102350 0.00
crit 289.1 18.70% 6524.09 9 8327 6527.36 6321 6870 1886261 1886261 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1208 (4401) 1.2% (4.4%) 32.6 8.77sec 40434 47189 Direct 33.4 9058 18124 10754 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.56 33.44 0.00 0.00 0.8569 0.0000 359582.97 359582.97 0.00 47189.27 47189.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.18 81.29% 9057.90 7949 10838 9069.38 8519 10225 246185 246185 0.00
crit 6.26 18.71% 18124.02 15898 21676 18132.51 0 21676 113398 113398 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3193 3.2% 18.2 15.59sec 52474 0 Direct 127.7 7495 0 7495 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.24 127.66 0.00 0.00 0.0000 0.0000 956997.70 956997.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.66 100.00% 7495.45 5962 16257 7499.84 6105 9922 956998 956998 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starfall 30524 30.9% 40.7 7.37sec 224805 215138 Periodic 2540.3 3032 6061 3599 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.66 0.00 0.00 2540.27 1.0449 0.0000 9141642.38 9141642.38 0.00 215137.96 215137.96
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2065.0 81.29% 3031.98 2838 3869 3033.53 2961 3167 6261228 6261228 0.00
crit 475.2 18.71% 6061.09 5675 7738 6064.06 5859 6361 2880415 2880415 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 311 0.3% 1.4 268.97sec 65308 76875 Direct 1.2 62676 125771 74695 19.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.23 0.00 0.00 0.8498 0.0000 91788.62 91788.62 0.00 76874.89 76874.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 81.00% 62676.22 51347 69612 53434.93 0 69612 62414 62414 0.00
crit 0.23 19.00% 125770.94 102695 139223 28581.68 0 139223 29375 29375 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2999 3.0% 45.6 4.50sec 19432 0 Direct 45.6 16388 32767 19432 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.65 45.65 0.00 0.00 0.0000 0.0000 887032.29 887032.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.17 81.42% 16387.81 16021 17623 16387.89 16021 17541 609060 609060 0.00
crit 8.48 18.58% 32767.09 32042 35246 32759.09 0 35246 277972 277972 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 20035 20.3% 18.4 16.47sec 326117 319761 Direct 18.4 4442 8868 5266 18.6%  
Periodic 1559.2 3190 6375 3785 18.7% 695.4%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.40 18.40 1559.17 1559.17 1.0199 1.3376 5999028.96 5999028.96 0.00 2850.92 319760.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.97 81.36% 4441.67 4112 5607 4443.91 4194 4816 66475 66475 0.00
crit 3.43 18.64% 8868.47 8225 11214 8672.81 0 11214 30412 30412 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1267.8 81.31% 3190.30 447 4065 3191.90 3119 3349 4044787 4044787 0.00
crit 291.3 18.69% 6375.17 894 8130 6378.32 6181 6650 1857355 1857355 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.92sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.71sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8785 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 255.5sec 94.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:92.70%
  • arcanic_pulsar_2:1.55%
  • arcanic_pulsar_3:0.03%
  • arcanic_pulsar_4:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 190.7sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.9sec 182.9sec 8.11% 7.58% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 182.7sec 182.7sec 13.52% 18.35% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.4sec 45.6sec 23.53% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 20.7 193.4 13.3sec 1.4sec 97.39% 94.96% 110.1(110.1) 19.7

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:11.29%
  • focused_energy_4:8.48%
  • focused_energy_5:6.98%
  • focused_energy_6:5.88%
  • focused_energy_7:5.12%
  • focused_energy_8:4.61%
  • focused_energy_9:4.10%
  • focused_energy_10:50.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of Elune 5.3 0.0 60.9sec 60.9sec 13.97% 0.00% 83.7(83.7) 5.2

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.01% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.5 1.6 45.0sec 35.3sec 9.15% 8.88% 0.1(0.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.79%
  • lunar_empowerment_2:1.74%
  • lunar_empowerment_3:0.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.9sec 34.6sec 47.44% 0.00% 3.4(46.3) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.07%
  • overwhelming_power_17:2.13%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.47%
  • overwhelming_power_23:2.55%
  • overwhelming_power_24:2.61%
  • overwhelming_power_25:1.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 18.7 0.1 15.6sec 15.5sec 12.73% 54.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.69%
  • solar_empowerment_2:0.04%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 19.7 21.0 15.4sec 7.4sec 89.91% 0.00% 21.0(21.0) 18.9

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:89.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 14.1 28.0 22.1sec 7.2sec 90.15% 88.43% 1.1(1.1) 11.7

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.11%
  • starlord_2:32.13%
  • starlord_3:25.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.7sec 45.5sec 23.82% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.82%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starfall Astral Power 40.7 2033.3 50.0 50.0 4496.1
starsurge Astral Power 1.4 56.2 40.0 40.0 1633.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 33.56 268.45 (13.08%) 8.00 0.06 0.02%
celestial_alignment Astral Power 2.00 80.00 (3.90%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.72 209.29 (10.19%) 2.50 0.00 0.00%
sunfire Astral Power 18.39 55.18 (2.69%) 3.00 0.00 0.00%
moonfire Astral Power 64.35 193.06 (9.40%) 3.00 0.00 0.00%
lunar_strike Astral Power 87.25 1046.98 (50.99%) 12.00 0.05 0.00%
natures_balance Astral Power 400.35 200.16 (9.75%) 0.50 0.02 0.01%
Resource RPS-Gain RPS-Loss
Astral Power 6.85 6.97
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.18 0.00 61.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data focusing iris Damage Per Second
Count 2851
Mean 98906.45
Minimum 92017.70
Maximum 106717.81
Spread ( max - min ) 14700.10
Range [ ( max - min ) / 2 * 100% ] 7.43%
Standard Deviation 2360.8608
5th Percentile 95276.83
95th Percentile 102982.28
( 95th Percentile - 5th Percentile ) 7705.45
Mean Distribution
Standard Deviation 44.2152
95.00% Confidence Intervall ( 98819.79 - 98993.11 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2189
0.1 Scale Factor Error with Delta=300 47581
0.05 Scale Factor Error with Delta=300 190321
0.01 Scale Factor Error with Delta=300 4758001
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 2851
Mean 20138.61
Minimum 18250.29
Maximum 22823.00
Spread ( max - min ) 4572.72
Range [ ( max - min ) / 2 * 100% ] 11.35%
Standard Deviation 770.3319
5th Percentile 18954.71
95th Percentile 21457.99
( 95th Percentile - 5th Percentile ) 2503.28
Mean Distribution
Standard Deviation 14.4271
95.00% Confidence Intervall ( 20110.33 - 20166.89 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5621
0.1 Scale Factor Error with Delta=300 5066
0.05 Scale Factor Error with Delta=300 20263
0.01 Scale Factor Error with Delta=300 506570
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 2851
Mean 98906.45
Minimum 92017.70
Maximum 106717.81
Spread ( max - min ) 14700.10
Range [ ( max - min ) / 2 * 100% ] 7.43%
Damage
Sample Data focusing iris Damage
Count 2851
Mean 29606969.97
Minimum 23749578.00
Maximum 36145082.90
Spread ( max - min ) 12395504.90
Range [ ( max - min ) / 2 * 100% ] 20.93%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.30 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.51 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 40.67 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.40 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.25 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.27 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.15 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.08 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 87.88 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 32.61 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.99 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRQMQQKQRQQQQQJKPQKPPOPPPQQKQQQQKQQOPPIKPPQKQQQKOQQPRQKPPPPQRQKORQQKQPQPPPQKOPQQRQKGIRQKPPQOKPPPRQQQQQKQQKOQPPPQKPRQQQKQOQQQKPPPPPQQHEFKIKORQRKRQPKPRQRQRQOKPPQRKQQQPPPKOPPQRQKQQQQKQOPPPGQIKPQQKRQQKOQPQPPPQKPQQQKOQQQQKPPPPQQKOQQQRKQQIPPKPOPQKQQQQKQQPOPPKPQPQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.221 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, focused_energy(3), battle_potion_of_intellect
0:02.134 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, focused_energy(4), battle_potion_of_intellect
0:03.044 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, focused_energy(5), battle_potion_of_intellect
0:03.951 default P moonfire enemy3 27.5/100: 28% astral_power bloodlust, starlord, starfall, torrent_of_elements, focused_energy(6), battle_potion_of_intellect
0:04.854 default P moonfire enemy6 31.0/100: 31% astral_power bloodlust, starlord, starfall, torrent_of_elements, focused_energy(7), battle_potion_of_intellect
0:05.751 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, torrent_of_elements, focused_energy(7), battle_potion_of_intellect
0:07.099 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, torrent_of_elements, focused_energy(8), battle_potion_of_intellect
0:07.879 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, starfall, torrent_of_elements, focused_energy(9), battle_potion_of_intellect
0:07.879 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, starfall, torrent_of_elements, focused_energy(9), battle_potion_of_intellect
0:07.879 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, starfall, torrent_of_elements, focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:08.632 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.387 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:10.142 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:10.896 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:11.650 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:12.606 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.360 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.139 default O sunfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.897 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.650 default S sunfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.405 default L starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.159 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.914 default P moonfire Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.668 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.421 default P moonfire enemy5 76.5/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.176 default K starfall Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.930 default P moonfire enemy3 30.5/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.683 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.437 default P moonfire enemy4 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.188 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, focused_energy(10), ignition_mages_fuse(4)
0:23.942 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, focused_energy(10), ignition_mages_fuse(5)
0:24.696 default P moonfire enemy6 5.0/100: 5% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, focused_energy(10), ignition_mages_fuse(5)
0:25.451 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, focused_energy(10), ignition_mages_fuse(5)
0:26.204 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, focused_energy(10), ignition_mages_fuse(5)
0:26.991 default M sunfire Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, focused_energy(10), ignition_mages_fuse(5)
0:27.747 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(2), starfall, focused_energy(10), ignition_mages_fuse(5)
0:28.654 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, focused_energy(10)
0:29.754 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, focused_energy(10)
0:30.616 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(10)
0:31.873 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall, focused_energy(10)
0:32.628 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(10)
0:33.884 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(4)
0:35.174 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(5)
0:36.456 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(6)
0:37.734 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, focused_energy(7)
0:39.006 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, starlord(3), focused_energy(9)
0:39.006 default K starfall Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, focused_energy(9)
0:39.926 default P moonfire enemy2 45.5/100: 46% astral_power bloodlust, arcanic_pulsar, starlord, starfall, focused_energy(10)
0:40.813 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar, starlord, starfall, focused_energy(10)
0:42.142 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10)
0:43.296 default P moonfire enemy3 12.5/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), focused_energy(10)
0:44.327 default P moonfire enemy4 16.5/100: 17% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), focused_energy(3)
0:45.389 default O sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), focused_energy(3), conch_of_dark_whispers
0:46.457 default P moonfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), focused_energy(3), conch_of_dark_whispers
0:47.527 default P moonfire enemy6 27.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), focused_energy(3), conch_of_dark_whispers
0:48.584 default P moonfire enemy7 31.0/100: 31% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), focused_energy(3), conch_of_dark_whispers
0:49.643 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), focused_energy(3), conch_of_dark_whispers
0:51.225 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord(2), overwhelming_power(23), focused_energy(3), conch_of_dark_whispers
0:52.817 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord(2), overwhelming_power(22), focused_energy(3), conch_of_dark_whispers
0:53.881 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(25), focused_energy(5), conch_of_dark_whispers
0:55.410 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23), focused_energy(7), conch_of_dark_whispers
0:56.936 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22), focused_energy(9), conch_of_dark_whispers
0:58.454 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
0:59.978 default K starfall Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, starfall, overwhelming_power(19), focused_energy(10)
1:01.090 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), focused_energy(10)
1:02.719 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16), focused_energy(10)
1:04.352 default O sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
1:05.449 default P moonfire enemy3 44.5/100: 45% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
1:06.551 default P moonfire Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
1:07.657 default I fury_of_elune Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
1:08.987 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, fury_of_elune, starlord, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
1:10.100 default P moonfire enemy4 13.5/100: 14% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(8), focused_energy(4), conch_of_dark_whispers
1:11.216 default P moonfire enemy5 22.0/100: 22% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(7), focused_energy(5), conch_of_dark_whispers
1:12.331 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(6), focused_energy(6), conch_of_dark_whispers
1:14.002 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(4), focused_energy(8), conch_of_dark_whispers
1:15.117 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(3), focused_energy(8), conch_of_dark_whispers
1:16.744 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
1:18.365 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:19.996 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, starfall, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
1:21.182 default O sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:22.385 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, focused_energy(3), conch_of_dark_whispers
1:24.163 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, focused_energy(4), conch_of_dark_whispers
1:25.934 default P moonfire enemy3 35.0/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, focused_energy(5), conch_of_dark_whispers
1:27.113 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, focused_energy(5), conch_of_dark_whispers
1:28.113 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment, starlord, torrent_of_elements, focused_energy(6), conch_of_dark_whispers
1:29.607 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord, torrent_of_elements, focused_energy(7), conch_of_dark_whispers
1:30.774 default P moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, focused_energy(7), conch_of_dark_whispers
1:31.908 default P moonfire enemy2 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, focused_energy(8)
1:33.037 default P moonfire enemy7 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(8)
1:34.168 default P moonfire enemy6 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(8)
1:35.297 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall
1:37.048 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, focused_energy(4), conch_of_dark_whispers
1:38.025 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), focused_energy(5), conch_of_dark_whispers
1:39.483 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, solar_empowerment, starlord(2), focused_energy(6), conch_of_dark_whispers
1:40.622 default O sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, solar_empowerment, starfall, focused_energy(7), conch_of_dark_whispers
1:41.825 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, solar_empowerment, starfall, focused_energy(9), conch_of_dark_whispers
1:42.839 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, lunar_empowerment, starfall, focused_energy(10), conch_of_dark_whispers
1:44.353 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starfall, focused_energy(10), conch_of_dark_whispers
1:46.132 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starfall, focused_energy(10), conch_of_dark_whispers
1:47.319 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
1:49.047 default P moonfire enemy4 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
1:50.200 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
1:51.928 default P moonfire enemy2 31.5/100: 32% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
1:53.081 default P moonfire enemy5 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:54.283 default P moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, focused_energy(4), conch_of_dark_whispers
1:55.466 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord, focused_energy(4), conch_of_dark_whispers
1:57.237 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord, focused_energy(4)
1:58.418 default O sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(3)
1:59.571 default P moonfire enemy7 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4)
2:00.717 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4)
2:02.439 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4)
2:04.161 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(25), focused_energy(4)
2:05.056 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), focused_energy(5)
2:06.633 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(23), focused_energy(7)
2:07.744 default G use_items Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(22), focused_energy(8)
2:07.744 default I fury_of_elune Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(22), focused_energy(8), ignition_mages_fuse
2:08.910 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, overwhelming_power(21), focused_energy(9), ignition_mages_fuse
2:09.789 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(20), focused_energy(10), ignition_mages_fuse
2:11.340 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(18), focused_energy(10), ignition_mages_fuse
2:12.383 default P moonfire enemy4 8.5/100: 9% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(25), focused_energy(10), ignition_mages_fuse(2)
2:13.337 default P moonfire enemy2 14.5/100: 14% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(24), focused_energy(10), ignition_mages_fuse(2)
2:14.295 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(23), focused_energy(10), ignition_mages_fuse(2)
2:15.734 default O sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, overwhelming_power(22), focused_energy(4), ignition_mages_fuse(2)
2:16.718 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(21), focused_energy(4), ignition_mages_fuse(3)
2:17.668 default P moonfire enemy3 0.5/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(20), focused_energy(4), ignition_mages_fuse(3)
2:18.595 default P moonfire enemy5 4.0/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(19), focused_energy(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:19.525 default P moonfire enemy7 8.0/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(18), focused_energy(4), conch_of_dark_whispers, ignition_mages_fuse(3)
2:20.460 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(17), focused_energy(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.233 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(16), focused_energy(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.592 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(24), focused_energy(6), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.909 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(23), focused_energy(7), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.181 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(9), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.453 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.725 default K starfall Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:28.653 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
2:30.275 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
2:31.908 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
2:33.002 default O sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
2:34.073 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
2:35.684 default P moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
2:36.764 default P moonfire enemy2 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(10), focused_energy(10), conch_of_dark_whispers
2:37.848 default P moonfire enemy6 36.0/100: 36% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(9), focused_energy(10), conch_of_dark_whispers
2:38.933 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(8), focused_energy(10), conch_of_dark_whispers
2:40.566 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), focused_energy(4), conch_of_dark_whispers
2:41.690 default P moonfire enemy3 3.5/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(5), focused_energy(6), conch_of_dark_whispers
2:42.778 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(4), focused_energy(6), conch_of_dark_whispers
2:43.707 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(3), focused_energy(6), conch_of_dark_whispers
2:45.349 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power, focused_energy(6), conch_of_dark_whispers
2:47.003 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, focused_energy(4), conch_of_dark_whispers
2:48.677 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, torrent_of_elements, focused_energy(6), conch_of_dark_whispers
2:49.883 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord, starfall, focused_energy(8)
2:51.623 default O sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
2:52.776 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
2:54.503 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
2:56.230 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
2:57.958 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, starlord, focused_energy(10), conch_of_dark_whispers
2:59.112 default P moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
3:00.234 default P moonfire enemy2 17.0/100: 17% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
3:01.355 default P moonfire enemy4 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
3:02.476 default P moonfire enemy5 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
3:03.596 default P moonfire enemy6 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4), conch_of_dark_whispers
3:04.743 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4), conch_of_dark_whispers
3:06.464 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, focused_energy(4)
3:08.185 default H celestial_alignment Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, starlord(2), torrent_of_elements, focused_energy(3)
3:09.187 default E potion Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar, celestial_alignment, torrent_of_elements, focused_energy(3)
3:09.187 default F berserking Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar, celestial_alignment, torrent_of_elements, focused_energy(3), battle_potion_of_intellect
3:09.187 default K starfall Fluffy_Pillow 99.0/100: 99% astral_power berserking, arcanic_pulsar, celestial_alignment, torrent_of_elements, focused_energy(3), battle_potion_of_intellect
3:10.156 default I fury_of_elune Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, torrent_of_elements, focused_energy(4), battle_potion_of_intellect
3:11.092 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, torrent_of_elements, focused_energy(4), battle_potion_of_intellect
3:12.028 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(4), battle_potion_of_intellect
3:12.936 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(5), battle_potion_of_intellect
3:13.840 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), starfall, torrent_of_elements, focused_energy(5), battle_potion_of_intellect
3:14.992 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, solar_empowerment, starlord(2), starfall, torrent_of_elements, focused_energy(6), battle_potion_of_intellect
3:15.757 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(7), battle_potion_of_intellect
3:16.654 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(7), battle_potion_of_intellect
3:17.526 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, focused_energy(8), battle_potion_of_intellect
3:18.829 default P moonfire enemy2 46.5/100: 47% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, focused_energy(8), battle_potion_of_intellect
3:19.700 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, focused_energy(8), battle_potion_of_intellect
3:20.569 default P moonfire enemy4 0.5/100: 1% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, focused_energy(8), battle_potion_of_intellect
3:21.438 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect
3:22.427 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, focused_energy(3), battle_potion_of_intellect
3:23.889 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), starfall, focused_energy(4), battle_potion_of_intellect
3:24.715 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, focused_energy(5), conch_of_dark_whispers, battle_potion_of_intellect
3:25.948 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, focused_energy(6), conch_of_dark_whispers, battle_potion_of_intellect
3:26.912 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, focused_energy(7), conch_of_dark_whispers, battle_potion_of_intellect
3:28.347 default O sunfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, starlord(3), focused_energy(9), conch_of_dark_whispers, battle_potion_of_intellect
3:29.441 default K starfall Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:30.629 default P moonfire enemy3 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:31.691 default P moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:32.756 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect
3:34.356 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(20), focused_energy(3), conch_of_dark_whispers
3:35.293 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), focused_energy(4), conch_of_dark_whispers
3:36.398 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), focused_energy(6), conch_of_dark_whispers
3:38.000 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), focused_energy(9), conch_of_dark_whispers
3:39.595 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15), focused_energy(10)
3:41.189 default P moonfire enemy2 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), focused_energy(10)
3:42.260 default P moonfire enemy6 46.0/100: 46% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12), focused_energy(10)
3:43.334 default P moonfire enemy5 49.5/100: 50% astral_power arcanic_pulsar, starlord(2), overwhelming_power(11), focused_energy(10)
3:44.412 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(2), overwhelming_power(10), focused_energy(10)
3:45.493 default O sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(9), focused_energy(10)
3:46.547 default P moonfire enemy3 8.0/100: 8% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(8), focused_energy(10)
3:47.607 default P moonfire enemy7 11.5/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(7), focused_energy(10)
3:48.671 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(6), focused_energy(10)
3:50.270 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(4), focused_energy(10)
3:51.267 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starfall, overwhelming_power(3), focused_energy(10)
3:53.028 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, overwhelming_power, focused_energy(10), conch_of_dark_whispers
3:54.210 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
3:55.938 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
3:57.669 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
3:59.396 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers
4:01.123 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord, focused_energy(10), conch_of_dark_whispers
4:02.276 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
4:03.955 default O sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
4:05.073 default P moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
4:06.193 default P moonfire enemy2 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
4:07.312 default P moonfire enemy6 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10)
4:08.433 default G use_items Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers
4:08.433 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:10.044 default I fury_of_elune Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:11.231 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:12.305 default P moonfire enemy3 7.0/100: 7% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:13.350 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, fury_of_elune, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.990 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, fury_of_elune, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.630 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.682 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.552 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.084 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:21.617 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, starfall, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.603 default O sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(3), ignition_mages_fuse(4)
4:23.587 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(4), ignition_mages_fuse(4)
4:25.051 default P moonfire enemy6 19.5/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(6), ignition_mages_fuse(5)
4:25.988 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, focused_energy(6), ignition_mages_fuse(5)
4:27.394 default P moonfire enemy2 36.0/100: 36% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), focused_energy(6), ignition_mages_fuse(5)
4:28.270 default P moonfire enemy4 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), focused_energy(6), ignition_mages_fuse(5)
4:29.147 default P moonfire enemy5 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), focused_energy(3)
4:30.215 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord(2), overwhelming_power(21), focused_energy(3)
4:31.820 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(2), overwhelming_power(25), focused_energy(3)
4:32.877 default P moonfire enemy3 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24)
4:33.921 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(23), focused_energy(3)
4:35.470 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(21), focused_energy(5)
4:37.018 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(19), focused_energy(5)
4:38.718 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(18), focused_energy(5)
4:39.857 default O sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(17)
4:40.988 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(16), focused_energy(3)
4:42.666 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(14), focused_energy(4)
4:44.353 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(12), focused_energy(5)
4:46.043 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(10), focused_energy(5)
4:47.747 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(9), focused_energy(5)
4:48.886 default P moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(8)
4:50.020 default P moonfire enemy4 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(6), focused_energy(4)
4:51.144 default P moonfire enemy5 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(5), focused_energy(4)
4:52.274 default P moonfire enemy2 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4), focused_energy(4)
4:53.408 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(3), conch_of_dark_whispers
4:55.139 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power, focused_energy(4), conch_of_dark_whispers
4:56.853 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(2), focused_energy(5), conch_of_dark_whispers
4:57.997 default O sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord(3), starfall, focused_energy(6), conch_of_dark_whispers
4:59.105 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starfall, focused_energy(7), conch_of_dark_whispers
5:00.906 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starfall, focused_energy(9), conch_of_dark_whispers
5:02.693 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starfall, focused_energy(10), conch_of_dark_whispers
5:04.474 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starfall, focused_energy(10), conch_of_dark_whispers
5:05.484 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, focused_energy(10), conch_of_dark_whispers
5:06.670 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, focused_energy(10), conch_of_dark_whispers
5:08.398 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, focused_energy(10)
5:10.127 default I fury_of_elune Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, focused_energy(10)
5:11.310 default P moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, focused_energy(10)
5:12.463 default P moonfire enemy4 47.0/100: 47% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, focused_energy(10)
5:13.617 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, torrent_of_elements, focused_energy(10)
5:14.770 default P moonfire enemy2 14.0/100: 14% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements
5:15.939 default O sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(3)
5:17.093 default P moonfire enemy5 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, focused_energy(3)
5:18.246 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, focused_energy(3)
5:19.973 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, focused_energy(3)
5:21.127 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, focused_energy(5)
5:22.795 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, focused_energy(7)
5:24.449 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(3), starfall, focused_energy(9)
5:26.088 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, starfall, focused_energy(10)
5:27.870 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starfall, focused_energy(10)
5:29.056 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), focused_energy(10)
5:30.646 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), focused_energy(10)
5:32.240 default P moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21), focused_energy(10)
5:33.312 default O sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(20), focused_energy(10)
5:34.387 default P moonfire enemy3 43.5/100: 44% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), focused_energy(10)
5:35.465 default P moonfire enemy2 47.5/100: 48% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18), focused_energy(10)
5:36.548 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord, overwhelming_power(17)
5:37.676 default P moonfire enemy6 2.0/100: 2% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), focused_energy(3)
5:38.766 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15), focused_energy(3)
5:40.404 default P moonfire enemy4 18.5/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), focused_energy(3)
5:41.506 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12), focused_energy(3)
5:43.162 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(10), focused_energy(6)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

life-force : 96632 dps, 19791 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
96632.4 96632.4 83.3 / 0.086% 8671.1 / 9.0% 14266.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 96632
Azerite Spike 842 0.9% 16.1 18.17sec 15653 0 Direct 16.1 13216 26431 15670 18.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.12 16.10 0.00 0.00 0.0000 0.0000 252302.55 252302.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.11 81.44% 13216.27 12872 14867 13214.25 12872 13943 173305 173305 0.00
crit 2.99 18.56% 26430.98 25743 29734 25189.52 0 29734 78998 78998 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11696.33
  • base_dd_max:11696.33
  • base_dd_mult:1.00
 
Fury of Elune 5879 6.1% 5.3 61.16sec 332945 325251 Direct 891.5 1664 3324 1971 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 891.51 136.86 0.00 1.0237 0.3048 1757332.74 1757332.74 0.00 37298.80 325251.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 726.57 81.50% 1664.20 1457 2086 1666.19 1591 1826 1209123 1209123 0.00
crit 164.95 18.50% 3323.54 2915 4173 3326.84 3105 3739 548210 548210 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 284 (1136) 0.3% (1.2%) 7.8 34.31sec 43424 0 Direct 7.8 9166 18328 10878 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 85236.42 85236.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 81.33% 9166.21 8921 10304 9169.04 8921 9976 58417 58417 0.00
crit 1.46 18.67% 18327.88 17842 20607 14227.74 0 20607 26820 26820 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 851 0.9% 7.8 34.31sec 32547 0 Direct 54.9 3921 7843 4650 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 54.86 0.00 0.00 0.0000 0.0000 255058.45 255058.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.66 81.41% 3920.54 3823 4416 3921.53 3823 4228 175083 175083 0.00
crit 10.20 18.59% 7843.13 7646 8832 7842.27 0 8551 79976 79976 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11087 11.5% 82.9 3.55sec 40105 25223 Direct 580.2 4830 9642 5729 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.89 580.20 0.00 0.00 1.5900 0.0000 3324127.66 3324127.66 0.00 25223.30 25223.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.77 81.31% 4829.92 3345 25422 4834.74 4498 5350 2278636 2278636 0.00
crit 108.44 18.69% 9642.19 6689 50843 9649.69 7874 12202 1045492 1045492 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21146 21.9% 64.3 4.59sec 98413 90820 Direct 128.7 3484 6965 4129 18.5%  
Periodic 1494.5 3270 6537 3882 18.7% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.35 128.70 1494.46 1494.46 1.0836 1.3843 6332778.99 6332778.99 0.00 2961.24 90819.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.83 81.45% 3483.75 3280 4695 3485.23 3373 3630 365190 365190 0.00
crit 23.87 18.55% 6965.01 6559 9391 6967.64 6559 7788 166264 166264 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1214.7 81.28% 3270.41 2 4371 3272.03 3194 3415 3972695 3972695 0.00
crit 279.7 18.72% 6537.20 4 8743 6540.05 6345 6914 1828630 1828630 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1173 (4193) 1.2% (4.3%) 31.5 9.01sec 39872 45514 Direct 32.4 9118 18223 10793 18.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.47 32.36 0.00 0.00 0.8761 0.0000 349240.12 349240.12 0.00 45514.21 45514.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.41 81.61% 9117.72 7949 11380 9129.37 8533 10164 240775 240775 0.00
crit 5.95 18.39% 18222.66 15898 22760 18209.28 0 21742 108465 108465 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3021 3.1% 17.2 16.46sec 52551 0 Direct 120.6 7508 0 7508 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 120.64 0.00 0.00 0.0000 0.0000 905677.79 905677.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.64 100.00% 7507.74 5962 17070 7512.85 6092 10452 905678 905678 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starfall 29655 30.7% 39.4 7.61sec 225222 209269 Periodic 2464.4 3038 6073 3604 18.6% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.43 0.00 0.00 2464.39 1.0762 0.0000 8881364.17 8881364.17 0.00 209268.71 209268.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2005.0 81.36% 3038.11 2838 4062 3039.62 2969 3184 6091445 6091445 0.00
crit 459.4 18.64% 6073.18 5675 8125 6075.83 5867 6480 2789919 2789919 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 308 0.3% 1.4 269.21sec 64981 75389 Direct 1.2 63142 125896 74121 17.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.23 0.00 0.00 0.8621 0.0000 90918.85 90918.85 0.00 75388.77 75388.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.01 82.47% 63142.42 51347 73092 54588.94 0 73092 63850 63850 0.00
crit 0.22 17.53% 125895.88 102695 146185 25976.50 0 146185 27069 27069 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2968 3.0% 45.0 4.60sec 19509 0 Direct 45.0 16472 32940 19509 18.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.01 45.01 0.00 0.00 0.0000 0.0000 878084.84 878084.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.71 81.56% 16471.86 16021 18504 16472.26 16021 17718 604644 604644 0.00
crit 8.30 18.44% 32940.25 32042 37008 32925.83 0 36303 273441 273441 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19420 20.1% 18.5 16.36sec 314380 299423 Direct 18.5 4461 8922 5301 18.8%  
Periodic 1507.2 3196 6387 3793 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.50 18.50 1507.19 1507.19 1.0500 1.3835 5815086.52 5815086.52 0.00 2763.06 299422.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.01 81.17% 4460.81 4112 5887 4463.00 4186 4770 66973 66973 0.00
crit 3.48 18.83% 8921.63 8225 11775 8710.58 0 11775 31078 31078 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1225.3 81.30% 3196.41 2 4268 3197.97 3126 3333 3916678 3916678 0.00
crit 281.9 18.70% 6387.46 8 8537 6390.41 6178 6732 1800357 1800357 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.09sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.87sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9083 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 266.2sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.37%
  • arcanic_pulsar_2:0.81%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.0sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.8sec 183.8sec 13.52% 19.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.7sec 45.6sec 23.51% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.1sec 61.1sec 13.92% 0.00% 83.4(83.4) 5.2

Buff details

  • buff initial source:life-force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.01% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 47.0sec 36.6sec 9.37% 9.05% 0.1(0.1) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.95%
  • lunar_empowerment_2:1.84%
  • lunar_empowerment_3:0.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.4 3.2 65.5sec 35.3sec 46.06% 0.00% 3.2(44.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.34%
  • overwhelming_power_2:1.38%
  • overwhelming_power_3:1.42%
  • overwhelming_power_4:1.45%
  • overwhelming_power_5:1.49%
  • overwhelming_power_6:1.53%
  • overwhelming_power_7:1.57%
  • overwhelming_power_8:1.61%
  • overwhelming_power_9:1.66%
  • overwhelming_power_10:1.70%
  • overwhelming_power_11:1.75%
  • overwhelming_power_12:1.80%
  • overwhelming_power_13:1.85%
  • overwhelming_power_14:1.90%
  • overwhelming_power_15:1.96%
  • overwhelming_power_16:2.01%
  • overwhelming_power_17:2.07%
  • overwhelming_power_18:2.13%
  • overwhelming_power_19:2.19%
  • overwhelming_power_20:2.26%
  • overwhelming_power_21:2.32%
  • overwhelming_power_22:2.39%
  • overwhelming_power_23:2.46%
  • overwhelming_power_24:2.52%
  • overwhelming_power_25:1.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.7 0.1 16.5sec 16.4sec 12.73% 52.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.68%
  • solar_empowerment_2:0.05%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.9 18.6 14.5sec 7.6sec 87.99% 0.00% 18.6(18.6) 20.2

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:87.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.6sec 7.4sec 88.23% 85.56% 1.2(1.2) 11.5

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.88%
  • starlord_2:31.07%
  • starlord_3:24.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.3sec 23.72% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.72%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:life-force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starfall Astral Power 39.4 1971.7 50.0 50.0 4504.5
starsurge Astral Power 1.4 56.0 40.0 40.0 1624.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.47 259.74 (13.04%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.40 208.50 (10.47%) 2.50 0.00 0.00%
sunfire Astral Power 18.50 55.49 (2.79%) 3.00 0.00 0.00%
moonfire Astral Power 64.35 193.05 (9.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.89 994.66 (49.94%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.16 (10.05%) 0.50 0.01 0.01%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.76
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.66 0.00 60.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data life-force Damage Per Second
Count 2851
Mean 96632.39
Minimum 90198.65
Maximum 105989.01
Spread ( max - min ) 15790.36
Range [ ( max - min ) / 2 * 100% ] 8.17%
Standard Deviation 2269.9263
5th Percentile 93110.59
95th Percentile 100487.87
( 95th Percentile - 5th Percentile ) 7377.29
Mean Distribution
Standard Deviation 42.5122
95.00% Confidence Intervall ( 96549.06 - 96715.71 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2120
0.1 Scale Factor Error with Delta=300 43986
0.05 Scale Factor Error with Delta=300 175942
0.01 Scale Factor Error with Delta=300 4398527
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 2851
Mean 19790.97
Minimum 17830.62
Maximum 22766.90
Spread ( max - min ) 4936.28
Range [ ( max - min ) / 2 * 100% ] 12.47%
Standard Deviation 763.9491
5th Percentile 18628.39
95th Percentile 21108.54
( 95th Percentile - 5th Percentile ) 2480.15
Mean Distribution
Standard Deviation 14.3076
95.00% Confidence Intervall ( 19762.92 - 19819.01 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5724
0.1 Scale Factor Error with Delta=300 4983
0.05 Scale Factor Error with Delta=300 19929
0.01 Scale Factor Error with Delta=300 498211
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 2851
Mean 96632.39
Minimum 90198.65
Maximum 105989.01
Spread ( max - min ) 15790.36
Range [ ( max - min ) / 2 * 100% ] 8.17%
Damage
Sample Data life-force Damage
Count 2851
Mean 28927209.12
Minimum 23035093.57
Maximum 35476044.30
Spread ( max - min ) 12440950.73
Range [ ( max - min ) / 2 * 100% ] 21.50%
DTPS
Sample Data life-force Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.43 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.40 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.34 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.32 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.10 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.03 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.52 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.53 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.06 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRMQQQKRRQQQQQRJKKPPOPPPQQKRQQQRKQOPPPIPKPRQKQQQOKQPPRQPPKPQQORQKRQPQRKPQPPOQRKQQQGIKPQRKOPPPPQQKQQRQQKPOQQKPPPPPQQKRQOQRQKPRQPPPKQORQHEFIKRQKRQKPRPRPRKOPRQMPQQQKRQKQPPQPOPQKQQQKQQQGPOPKPIPRQKQQQKQOQQKPPPPPQQKQROQQKQPPPQQKPQOQQKQQQQIKPPOPKPQQQKQQRQPKOPPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.165 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.090 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.015 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.940 default P moonfire enemy5 31.0/100: 31% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:05.866 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:07.253 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:08.060 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, battle_potion_of_intellect
0:08.060 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect
0:08.060 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:08.815 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:09.571 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:10.326 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.079 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.835 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:12.829 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.582 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.534 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.289 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.044 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.797 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.551 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.306 default P moonfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.060 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.816 default P moonfire enemy2 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.570 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.322 default P moonfire enemy4 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.077 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.831 default P moonfire enemy5 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.585 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, ignition_mages_fuse(4)
0:24.339 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, ignition_mages_fuse(5)
0:25.093 default P moonfire enemy7 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:25.848 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:26.602 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:27.355 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(3), starlord(2), starfall, ignition_mages_fuse(5)
0:28.293 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(2), starfall, torrent_of_elements
0:29.437 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(2), starfall, torrent_of_elements
0:30.581 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar, solar_empowerment(2), starlord(2), starfall, torrent_of_elements
0:31.481 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar, solar_empowerment(2), starlord(3), starfall, torrent_of_elements
0:32.233 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements
0:32.988 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), starfall, torrent_of_elements
0:34.101 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, torrent_of_elements
0:35.411 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, torrent_of_elements
0:36.723 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, torrent_of_elements
0:38.035 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, torrent_of_elements
0:39.346 default R solar_wrath Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, starlord(3), torrent_of_elements
0:40.223 default J cancel_buff Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements
0:40.223 default K starfall Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, torrent_of_elements
0:41.177 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
0:42.381 default P moonfire enemy7 1.0/100: 1% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:43.549 default P moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:44.718 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:45.887 default P moonfire enemy2 12.5/100: 13% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:47.056 default P moonfire enemy4 16.0/100: 16% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:48.225 default P moonfire enemy6 20.0/100: 20% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements
0:49.392 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), torrent_of_elements
0:50.882 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(2)
0:52.634 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
0:53.802 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:54.768 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall
0:56.470 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24)
0:58.033 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22)
0:59.607 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(21)
1:00.504 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(20)
1:01.658 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(19)
1:03.341 default O sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(17)
1:04.471 default P moonfire enemy6 24.5/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(16)
1:05.606 default P moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(15)
1:06.744 default P moonfire enemy4 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(14)
1:07.887 default I fury_of_elune Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(13)
1:09.209 default P moonfire enemy7 42.0/100: 42% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11)
1:10.362 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10)
1:11.521 default P moonfire enemy3 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(9)
1:12.653 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(8)
1:13.618 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(7)
1:15.324 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(5), conch_of_dark_whispers
1:16.472 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(4), conch_of_dark_whispers
1:18.150 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(2), conch_of_dark_whispers
1:19.841 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power, conch_of_dark_whispers
1:21.539 default O sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
1:22.777 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
1:24.017 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:25.818 default P moonfire enemy2 15.0/100: 15% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, conch_of_dark_whispers
1:27.021 default P moonfire enemy6 19.0/100: 19% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, conch_of_dark_whispers
1:28.224 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, conch_of_dark_whispers
1:29.248 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:31.050 default P moonfire enemy7 44.5/100: 45% astral_power arcanic_pulsar, starlord, conch_of_dark_whispers
1:32.253 default P moonfire enemy4 48.5/100: 49% astral_power arcanic_pulsar, starlord, conch_of_dark_whispers
1:33.455 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, torrent_of_elements, conch_of_dark_whispers
1:34.657 default P moonfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:35.825 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:37.576 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:39.327 default O sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:40.495 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:41.487 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), torrent_of_elements
1:43.239 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements
1:44.478 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements
1:45.501 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:47.034 default P moonfire enemy2 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
1:48.236 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall
1:50.037 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
1:51.058 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord, starfall
1:52.261 default P moonfire enemy7 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall
1:53.429 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall
1:55.180 default P moonfire enemy5 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall
1:56.348 default P moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall
1:57.516 default O sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall
1:58.684 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord(2), starfall
2:00.435 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
2:01.431 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(2)
2:02.600 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall
2:04.302 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, starfall
2:06.157 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, starfall
2:08.012 default G use_items Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starfall
2:08.012 default I fury_of_elune Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starfall, ignition_mages_fuse
2:09.247 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, fury_of_elune, starfall, ignition_mages_fuse
2:10.432 default P moonfire enemy2 9.5/100: 10% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, ignition_mages_fuse
2:11.585 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, ignition_mages_fuse
2:13.311 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, ignition_mages_fuse(2)
2:14.251 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, ignition_mages_fuse(2)
2:15.357 default O sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(2)
2:16.430 default P moonfire enemy3 19.5/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(3)
2:17.462 default P moonfire enemy4 23.5/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(3)
2:18.493 default P moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(3)
2:19.523 default P moonfire enemy7 31.0/100: 31% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(3)
2:20.554 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(4)
2:22.041 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(4)
2:23.529 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(4)
2:24.449 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(5)
2:25.749 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(5)
2:27.050 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
2:27.804 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
2:29.115 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(19), conch_of_dark_whispers
2:30.705 default K starfall Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar, starfall, overwhelming_power(18), conch_of_dark_whispers
2:31.866 default P moonfire enemy2 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), conch_of_dark_whispers
2:32.998 default O sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16), conch_of_dark_whispers
2:34.134 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), conch_of_dark_whispers
2:35.787 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), conch_of_dark_whispers
2:37.446 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21), conch_of_dark_whispers
2:38.561 default P moonfire enemy7 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), conch_of_dark_whispers
2:39.648 default P moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19), conch_of_dark_whispers
2:40.739 default P moonfire enemy4 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), conch_of_dark_whispers
2:41.832 default P moonfire enemy5 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17), conch_of_dark_whispers
2:42.931 default P moonfire enemy6 21.5/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), conch_of_dark_whispers
2:44.034 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(14), conch_of_dark_whispers
2:45.698 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), overwhelming_power(13)
2:47.369 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(11)
2:48.492 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(10)
2:49.422 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(9)
2:51.069 default O sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starfall, overwhelming_power(7)
2:52.274 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starfall, overwhelming_power(6)
2:54.089 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(4)
2:55.127 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, starfall, overwhelming_power(3)
2:56.961 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(2)
2:58.191 default P moonfire enemy7 13.5/100: 14% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements
2:59.393 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements
3:00.416 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:02.215 default P moonfire enemy4 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:03.418 default P moonfire Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:04.619 default P moonfire enemy3 47.0/100: 47% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:05.820 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord, torrent_of_elements
3:07.021 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
3:08.771 default O sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements
3:09.941 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements
3:10.935 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
3:12.685 default H celestial_alignment Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements
3:13.700 default E potion Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements
3:13.700 default F berserking Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, battle_potion_of_intellect
3:13.700 default I fury_of_elune Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, torrent_of_elements, battle_potion_of_intellect
3:14.623 default K starfall Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), torrent_of_elements, battle_potion_of_intellect
3:15.548 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, battle_potion_of_intellect
3:16.447 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, battle_potion_of_intellect
3:17.793 default K starfall Fluffy_Pillow 73.5/100: 74% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starfall, torrent_of_elements, battle_potion_of_intellect
3:18.773 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, torrent_of_elements, battle_potion_of_intellect
3:19.726 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord, starfall, torrent_of_elements, battle_potion_of_intellect
3:20.937 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(24), battle_potion_of_intellect
3:21.810 default P moonfire enemy5 16.5/100: 17% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(23), battle_potion_of_intellect
3:22.661 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(22), battle_potion_of_intellect
3:23.517 default P moonfire enemy4 28.5/100: 28% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(21), battle_potion_of_intellect
3:24.374 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(20), battle_potion_of_intellect
3:25.233 default P moonfire enemy6 40.5/100: 41% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(25), battle_potion_of_intellect
3:26.078 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(24), battle_potion_of_intellect
3:27.010 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(23), battle_potion_of_intellect
3:27.947 default O sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(23), battle_potion_of_intellect
3:28.859 default P moonfire enemy3 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(22), battle_potion_of_intellect
3:29.774 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(21), battle_potion_of_intellect
3:30.689 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(20), battle_potion_of_intellect
3:31.862 default M sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(19), battle_potion_of_intellect
3:32.785 default P moonfire enemy2 35.5/100: 36% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(18), battle_potion_of_intellect
3:33.850 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(17), battle_potion_of_intellect
3:35.448 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:37.059 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:38.682 default K starfall Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(12), battle_potion_of_intellect
3:39.869 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(11)
3:40.850 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(10)
3:42.587 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(8)
3:43.754 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(7)
3:45.460 default P moonfire enemy4 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(5)
3:46.608 default P moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4)
3:47.761 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(3)
3:49.491 default P moonfire enemy3 35.5/100: 36% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power
3:50.655 default O sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(2)
3:51.824 default P moonfire enemy6 43.5/100: 44% astral_power arcanic_pulsar, starlord(2)
3:52.991 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord(2)
3:54.742 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(2)
3:55.912 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(3), starfall
3:57.614 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starlord(3), starfall
3:59.317 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starfall
4:01.175 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starfall
4:02.413 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord, starfall
4:04.215 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall
4:06.016 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord, starfall
4:07.819 default G use_items Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
4:07.819 default P moonfire enemy4 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, ignition_mages_fuse
4:08.971 default O sunfire Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, ignition_mages_fuse
4:10.122 default P moonfire enemy2 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
4:11.272 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
4:12.423 default P moonfire enemy3 3.0/100: 3% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.496 default I fury_of_elune Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.774 default P moonfire enemy5 12.5/100: 13% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.849 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.724 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.038 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(3)
4:19.068 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.571 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.017 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers, ignition_mages_fuse(4)
4:23.594 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers, ignition_mages_fuse(4)
4:24.646 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.123 default O sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.108 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
4:28.583 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
4:30.384 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
4:31.586 default P moonfire enemy5 7.0/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
4:32.753 default P moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
4:33.924 default P moonfire enemy2 14.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
4:35.091 default P moonfire enemy3 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
4:36.260 default P moonfire enemy7 22.0/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
4:37.429 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
4:39.180 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, conch_of_dark_whispers
4:40.931 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
4:42.003 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
4:43.578 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(21)
4:44.473 default O sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(20)
4:45.627 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(19)
4:47.360 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(17)
4:49.104 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, overwhelming_power(15)
4:50.277 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14)
4:51.988 default P moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(25)
4:53.085 default P moonfire enemy2 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23)
4:54.192 default P moonfire enemy3 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22)
4:55.303 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21)
4:56.975 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(20)
4:58.651 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord, overwhelming_power(18)
4:59.777 default P moonfire enemy6 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17)
5:00.875 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16)
5:02.528 default O sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(14)
5:03.639 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13)
5:05.307 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11)
5:06.987 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(2), overwhelming_power(10)
5:08.114 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(8)
5:09.767 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starfall, overwhelming_power(7)
5:11.575 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starfall, overwhelming_power(5)
5:13.395 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starfall, overwhelming_power(3)
5:15.230 default I fury_of_elune Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, overwhelming_power
5:16.461 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, fury_of_elune
5:17.702 default P moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements
5:18.903 default P moonfire enemy2 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(25)
5:20.002 default O sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(23)
5:21.110 default P moonfire enemy3 47.5/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(22)
5:22.223 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(21)
5:23.338 default P moonfire enemy4 14.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(20)
5:24.426 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
5:26.059 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
5:27.704 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
5:29.354 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
5:30.461 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
5:32.085 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
5:33.719 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(10), conch_of_dark_whispers
5:34.650 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(9), conch_of_dark_whispers
5:36.301 default P moonfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(7), conch_of_dark_whispers
5:37.408 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, overwhelming_power(6), conch_of_dark_whispers
5:38.620 default O sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(5), conch_of_dark_whispers
5:39.800 default P moonfire enemy2 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(4)
5:40.985 default P moonfire enemy3 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(3)
5:42.174 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 98871 dps, 20001 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
98871.5 98871.5 98.7 / 0.100% 10425.1 / 10.5% 13550.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.3 7.2 Astral Power 0.00% 51.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 98871
Fury of Elune 5951 6.0% 5.3 60.95sec 334953 328077 Direct 896.2 1675 3343 1984 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.31 896.24 137.80 0.00 1.0211 0.3041 1778505.58 1778505.58 0.00 37576.71 328077.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 729.82 81.43% 1674.63 1457 2071 1676.63 1599 1824 1222161 1222161 0.00
crit 166.43 18.57% 3342.87 2915 4142 3346.33 3115 3720 556345 556345 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 291 (1162) 0.3% (1.2%) 8.0 33.92sec 43574 0 Direct 8.0 9187 18345 10897 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 87131.42 87131.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 81.32% 9186.95 8921 10228 9184.09 0 10090 59731 59731 0.00
crit 1.49 18.68% 18345.18 17842 20456 14209.24 0 20456 27400 27400 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 871 0.9% 8.0 33.92sec 32676 0 Direct 56.0 3936 7872 4668 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 55.97 0.00 0.00 0.0000 0.0000 261249.99 261249.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.56 81.41% 3936.11 3823 4384 3935.92 3823 4268 179338 179338 0.00
crit 10.40 18.59% 7872.26 7646 8767 7867.71 0 8648 81912 81912 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11120 11.3% 82.7 3.55sec 40311 25572 Direct 578.8 4850 9711 5759 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.69 578.85 0.00 0.00 1.5764 0.0000 3333394.11 3333394.11 0.00 25572.06 25572.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 470.67 81.31% 4850.13 3345 25236 4855.09 4489 5556 2282868 2282868 0.00
crit 108.18 18.69% 9711.10 6689 50471 9722.85 7723 12156 1050526 1050526 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21322 21.6% 64.1 4.61sec 99552 92857 Direct 128.3 3494 6983 4144 18.6%  
Periodic 1501.7 3286 6567 3898 18.7% 689.1%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.14 128.29 1501.72 1501.72 1.0721 1.3761 6385516.88 6385516.88 0.00 2990.58 92857.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.38 81.36% 3494.19 3280 4661 3495.88 3386 3705 364718 364718 0.00
crit 23.91 18.64% 6983.07 6559 9322 6988.12 6586 7707 166963 166963 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1221.5 81.34% 3285.79 6 4339 3287.53 3204 3425 4013507 4013507 0.00
crit 280.3 18.66% 6566.63 10 8679 6569.64 6348 6895 1840330 1840330 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1160 (4188) 1.2% (4.2%) 31.1 9.15sec 40299 46078 Direct 32.0 9127 18246 10803 18.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.12 32.00 0.00 0.00 0.8746 0.0000 345766.76 345766.76 0.00 46078.08 46078.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.12 81.61% 9126.63 7949 11297 9139.15 8468 10157 238381 238381 0.00
crit 5.89 18.39% 18246.18 15898 22594 18241.51 0 22594 107385 107385 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3028 3.1% 17.3 16.49sec 52665 0 Direct 120.8 7523 0 7523 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.25 120.75 0.00 0.00 0.0000 0.0000 908478.61 908478.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.75 100.00% 7522.69 5962 16945 7526.38 6068 10033 908479 908479 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6213.97
  • base_dd_max:6213.97
  • base_dd_mult:1.00
 
Starfall 32239 32.6% 42.5 7.05sec 227122 211477 Periodic 2654.7 3065 6126 3637 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 0.00 0.00 2654.73 1.0740 0.0000 9654331.91 9654331.91 0.00 211476.65 211476.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2158.9 81.32% 3064.84 2838 4033 3066.17 2977 3222 6616685 6616685 0.00
crit 495.8 18.68% 6126.14 5675 8065 6128.55 5922 6443 3037647 3037647 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 321 0.3% 1.5 184.78sec 64461 73407 Direct 1.3 61934 123593 73611 19.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.47 1.29 0.00 0.00 0.8788 0.0000 94622.20 94622.20 0.00 73407.44 73407.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.04 81.03% 61934.27 51347 72557 47805.45 0 72557 64494 64494 0.00
crit 0.24 18.97% 123592.53 102695 145115 28457.34 0 145115 30129 30129 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2944 2.9% 44.4 4.65sec 19618 0 Direct 44.4 16557 33112 19617 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.37 44.37 0.00 0.00 0.0000 0.0000 870482.41 870482.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.17 81.51% 16556.67 16021 18369 16556.27 16021 17976 598826 598826 0.00
crit 8.20 18.49% 33111.58 32042 36737 33125.55 32042 36737 271657 271657 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19625 19.9% 18.1 16.82sec 325101 310702 Direct 18.1 4456 8910 5271 18.3%  
Periodic 1516.9 3212 6421 3811 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.07 18.07 1516.89 1516.89 1.0464 1.3747 5875997.82 5875997.82 0.00 2792.55 310702.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.77 81.69% 4456.02 4112 5844 4457.91 4195 4842 65795 65795 0.00
crit 3.31 18.31% 8910.48 8225 11689 8686.24 0 11689 29484 29484 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1233.9 81.34% 3212.11 18 4237 3213.81 3123 3344 3963291 3963291 0.00
crit 283.0 18.66% 6421.04 36 8474 6424.01 6203 6739 1817428 1817428 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 183.20sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.98sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9057 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 0.9 0.4 0.0sec 165.6sec 80.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:67.00%
  • arcanic_pulsar_2:12.71%
  • arcanic_pulsar_3:0.70%
  • arcanic_pulsar_4:0.00%
  • arcanic_pulsar_5:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 190.4sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 183.1sec 183.1sec 8.11% 8.39% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 182.9sec 182.9sec 13.52% 19.02% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.2sec 46.1sec 23.44% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 60.9sec 60.9sec 13.99% 0.00% 83.8(83.8) 5.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.05% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.81%
  • ignition_mages_fuse_4:3.75%
  • ignition_mages_fuse_5:3.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 5.5 1.1 48.0sec 39.2sec 16.04% 0.00% 1.1(1.1) 5.4

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:16.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 6.5 1.4 45.0sec 36.8sec 8.60% 9.00% 0.1(0.1) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.76%
  • lunar_empowerment_2:1.40%
  • lunar_empowerment_3:0.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.3 64.9sec 34.5sec 46.92% 0.00% 3.3(46.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.36%
  • overwhelming_power_2:1.39%
  • overwhelming_power_3:1.43%
  • overwhelming_power_4:1.47%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.59%
  • overwhelming_power_8:1.64%
  • overwhelming_power_9:1.68%
  • overwhelming_power_10:1.73%
  • overwhelming_power_11:1.78%
  • overwhelming_power_12:1.83%
  • overwhelming_power_13:1.88%
  • overwhelming_power_14:1.94%
  • overwhelming_power_15:2.00%
  • overwhelming_power_16:2.06%
  • overwhelming_power_17:2.12%
  • overwhelming_power_18:2.18%
  • overwhelming_power_19:2.24%
  • overwhelming_power_20:2.31%
  • overwhelming_power_21:2.38%
  • overwhelming_power_22:2.45%
  • overwhelming_power_23:2.52%
  • overwhelming_power_24:2.59%
  • overwhelming_power_25:1.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.7 0.2 16.5sec 16.3sec 12.93% 53.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.83%
  • solar_empowerment_2:0.10%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 19.1 23.4 15.9sec 7.1sec 88.27% 0.00% 23.4(23.4) 18.3

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 14.4 29.6 21.6sec 6.9sec 91.99% 88.07% 2.0(2.0) 11.6

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:27.08%
  • starlord_2:32.34%
  • starlord_3:32.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.6sec 45.5sec 23.83% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.83%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starfall Astral Power 42.5 2125.3 50.0 50.0 4542.5
starsurge Astral Power 1.5 58.7 40.0 40.0 1611.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.12 256.84 (11.95%) 8.00 0.14 0.06%
celestial_alignment Astral Power 2.00 80.00 (3.72%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.79 209.47 (9.75%) 2.50 0.01 0.00%
sunfire Astral Power 18.07 54.22 (2.52%) 3.00 0.00 0.00%
moonfire Astral Power 64.14 192.42 (8.95%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.70 992.23 (46.17%) 12.00 0.12 0.01%
lucid_dreams Astral Power 6.59 163.68 (7.62%) 24.84 0.00 0.00%
natures_balance Astral Power 400.35 200.17 (9.31%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.17 7.28
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.71 0.50 73.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data lucid dreams Damage Per Second
Count 2851
Mean 98871.49
Minimum 89995.15
Maximum 108397.81
Spread ( max - min ) 18402.66
Range [ ( max - min ) / 2 * 100% ] 9.31%
Standard Deviation 2689.3343
5th Percentile 94649.27
95th Percentile 103324.35
( 95th Percentile - 5th Percentile ) 8675.08
Mean Distribution
Standard Deviation 50.3670
95.00% Confidence Intervall ( 98772.77 - 98970.21 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2843
0.1 Scale Factor Error with Delta=300 61741
0.05 Scale Factor Error with Delta=300 246964
0.01 Scale Factor Error with Delta=300 6174095
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 2851
Mean 20001.23
Minimum 17665.82
Maximum 22711.57
Spread ( max - min ) 5045.75
Range [ ( max - min ) / 2 * 100% ] 12.61%
Standard Deviation 795.3836
5th Percentile 18774.23
95th Percentile 21373.45
( 95th Percentile - 5th Percentile ) 2599.22
Mean Distribution
Standard Deviation 14.8963
95.00% Confidence Intervall ( 19972.03 - 20030.42 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6075
0.1 Scale Factor Error with Delta=300 5401
0.05 Scale Factor Error with Delta=300 21603
0.01 Scale Factor Error with Delta=300 540054
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 2851
Mean 98871.49
Minimum 89995.15
Maximum 108397.81
Spread ( max - min ) 18402.66
Range [ ( max - min ) / 2 * 100% ] 9.31%
Damage
Sample Data lucid dreams Damage
Count 2851
Mean 29595477.69
Minimum 23160620.16
Maximum 36041993.85
Spread ( max - min ) 12881373.69
Range [ ( max - min ) / 2 * 100% ] 21.76%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.31 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 42.51 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.47 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.44 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.27 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 63.70 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.30 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.17 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.74 sunfire

Sample Sequence

012345678ACDKOPHFGIKPKPRPRQKRQRORQRQJKKRQRKNPPPQRQKQPOQQQRQKPRQKPPQKPOQPPQQQKQQIKPOPQKPPPPQQKQQQOKPQQQPPKPPRQOQQKQQRQKPPPPOQGIKQQQKQQKQROPPPPPQKRQQQKQQORQKPPPPPQQKQOQQKQPPPQPHEFIKPKOPRQRQKRQKRQRQPOKPPPQPQQKRQPQOKPPRQKPPQQQGKQOPIQKQPQKPRPPQQKOQQPPQKQQRPOKPPQQRQKPPQQOQKPPQPRIQKPQKOPQQQKPPPPQQKOQQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O sunfire Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, lucid_dreams, starlord, starfall, battle_potion_of_intellect
0:02.164 default P moonfire Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, lucid_dreams, starlord, starfall, battle_potion_of_intellect
0:03.089 default H celestial_alignment Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:03.893 default F berserking Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:03.893 default G use_items Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:03.893 default I fury_of_elune Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse
0:04.646 default K starfall Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, fury_of_elune, starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse
0:05.400 default P moonfire enemy3 48.0/100: 48% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:06.156 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:06.910 default P moonfire enemy4 9.5/100: 10% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:07.665 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, lucid_dreams, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:08.418 default P moonfire enemy7 29.0/100: 29% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:09.173 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:09.927 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.880 default K starfall Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.635 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.389 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.306 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.061 default O sunfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.815 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.572 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.352 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.109 default Q lunar_strike Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.077 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.077 default K starfall Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, celestial_alignment, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.832 default K starfall Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord, starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.588 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.342 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.303 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.056 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.811 default N moonfire Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, lucid_dreams, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.565 default P moonfire enemy2 6.5/100: 7% astral_power bloodlust, lucid_dreams, starlord(3), starfall, ignition_mages_fuse(5)
0:24.320 default P moonfire enemy3 10.0/100: 10% astral_power bloodlust, lucid_dreams, starlord(3), starfall
0:25.196 default P moonfire enemy5 13.5/100: 14% astral_power bloodlust, lucid_dreams, starlord(3), starfall
0:26.072 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, lucid_dreams, starlord(3), starfall
0:27.384 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, solar_empowerment, starlord(3), starfall
0:28.137 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, starlord(3), starfall
0:29.448 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, starlord(3), starfall
0:30.323 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, starlord(3), starfall
0:31.632 default P moonfire enemy6 15.0/100: 15% astral_power bloodlust, starlord(3), starfall
0:32.507 default O sunfire Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, starlord(3), starfall
0:33.382 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, starlord(3), starfall
0:34.693 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, starlord(3), starfall
0:36.004 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, starlord(3), starfall
0:37.314 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, solar_empowerment, starlord(3), starfall
0:38.067 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, starlord(3)
0:39.379 default K starfall Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, solar_empowerment
0:40.333 default P moonfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, solar_empowerment, starlord, starfall, overwhelming_power(24)
0:41.182 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power solar_empowerment, starlord, starfall, overwhelming_power(23)
0:42.123 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power starlord, starfall, overwhelming_power(22)
0:43.787 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power starlord, starfall, overwhelming_power(25)
0:44.887 default P moonfire enemy3 33.5/100: 34% astral_power lucid_dreams, starlord(2), starfall, overwhelming_power(24)
0:45.958 default P moonfire enemy4 37.5/100: 38% astral_power lucid_dreams, starlord(2), starfall, overwhelming_power(23)
0:47.036 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power lucid_dreams, starlord(2), starfall, overwhelming_power(21)
0:48.659 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power lucid_dreams, starlord(2), starfall, overwhelming_power(20)
0:49.745 default P moonfire enemy2 5.0/100: 5% astral_power lucid_dreams, starlord(3), starfall, overwhelming_power(19)
0:50.807 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power lucid_dreams, starlord(3), starfall, overwhelming_power(18)
0:51.872 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power starlord(3), starfall, overwhelming_power(17)
0:53.473 default P moonfire enemy6 25.5/100: 26% astral_power starlord(3), starfall, overwhelming_power(15)
0:54.549 default P moonfire enemy5 29.0/100: 29% astral_power starlord(3), starfall, overwhelming_power(14)
0:55.629 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power starlord(3), starfall, overwhelming_power(13)
0:57.252 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power starlord(3), overwhelming_power(11)
0:58.887 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power starlord(3), overwhelming_power(10)
1:00.527 default K starfall Fluffy_Pillow 72.0/100: 72% astral_power overwhelming_power(8)
1:01.731 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power starlord, starfall, overwhelming_power(7)
1:03.486 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power starlord, starfall, overwhelming_power(5)
1:05.255 default I fury_of_elune Fluffy_Pillow 49.5/100: 50% astral_power starlord, starfall, overwhelming_power(23)
1:06.361 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power fury_of_elune, starlord, starfall, overwhelming_power(22), conch_of_dark_whispers
1:07.472 default P moonfire enemy4 10.5/100: 11% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(21), conch_of_dark_whispers
1:08.555 default O sunfire Fluffy_Pillow 19.5/100: 20% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(20), conch_of_dark_whispers
1:09.643 default P moonfire Fluffy_Pillow 28.0/100: 28% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(19), conch_of_dark_whispers
1:10.734 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(18), conch_of_dark_whispers
1:12.373 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(16), conch_of_dark_whispers
1:13.474 default P moonfire enemy3 15.5/100: 16% astral_power starlord(3), starfall, overwhelming_power(15), conch_of_dark_whispers
1:14.550 default P moonfire enemy6 19.5/100: 20% astral_power starlord(3), starfall, overwhelming_power(14), conch_of_dark_whispers
1:15.629 default P moonfire enemy2 23.0/100: 23% astral_power starlord(3), starfall, overwhelming_power(13), conch_of_dark_whispers
1:16.713 default P moonfire enemy5 27.0/100: 27% astral_power starlord(3), starfall, overwhelming_power(12), conch_of_dark_whispers
1:17.801 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power starlord(3), starfall, overwhelming_power(11), conch_of_dark_whispers
1:19.436 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power starlord(3), starfall, overwhelming_power(9), conch_of_dark_whispers
1:21.082 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power overwhelming_power(7)
1:22.287 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power starlord, starfall, overwhelming_power(6)
1:24.049 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power starlord, starfall, overwhelming_power(24)
1:25.702 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power starlord, starfall, overwhelming_power(23)
1:27.360 default O sunfire Fluffy_Pillow 47.0/100: 47% astral_power starlord, starfall, overwhelming_power(21)
1:28.474 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power starlord, starfall, overwhelming_power(20)
1:29.593 default P moonfire enemy4 1.5/100: 2% astral_power starlord(2), starfall, overwhelming_power(19)
1:30.684 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power starlord(2), starfall, overwhelming_power(18)
1:32.324 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power starlord(2), starfall, overwhelming_power(16)
1:33.976 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power starlord(2), starfall, overwhelming_power(15)
1:35.633 default P moonfire enemy7 44.5/100: 45% astral_power solar_empowerment, starlord(2), starfall, overwhelming_power(13)
1:36.747 default P moonfire enemy6 48.0/100: 48% astral_power solar_empowerment, starlord(2), overwhelming_power(12)
1:37.865 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power solar_empowerment, starlord(2), overwhelming_power(11)
1:38.986 default P moonfire Fluffy_Pillow 2.5/100: 3% astral_power solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(10)
1:40.082 default P moonfire enemy2 6.5/100: 7% astral_power solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(8)
1:41.186 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power solar_empowerment, starfall, torrent_of_elements, overwhelming_power(7)
1:42.211 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power starfall, torrent_of_elements, overwhelming_power(6)
1:44.026 default O sunfire Fluffy_Pillow 32.0/100: 32% astral_power starfall, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
1:45.245 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power starfall, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
1:47.079 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power torrent_of_elements, overwhelming_power, conch_of_dark_whispers
1:48.927 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power torrent_of_elements, conch_of_dark_whispers
1:50.166 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:51.968 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:53.770 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power solar_empowerment, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:54.792 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:56.593 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:57.795 default P moonfire enemy5 12.5/100: 13% astral_power starlord(2), starfall, torrent_of_elements
1:58.963 default P moonfire enemy3 16.0/100: 16% astral_power starlord(2), starfall, torrent_of_elements
2:00.132 default P moonfire enemy6 20.0/100: 20% astral_power starlord(2), starfall, torrent_of_elements
2:01.302 default P moonfire enemy2 23.5/100: 24% astral_power starlord(2), starfall, torrent_of_elements
2:02.471 default O sunfire Fluffy_Pillow 27.5/100: 28% astral_power starlord(2), starfall, torrent_of_elements
2:03.639 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power starlord(2), starfall, torrent_of_elements
2:05.389 default G use_items Fluffy_Pillow 44.5/100: 45% astral_power starlord(2), torrent_of_elements
2:05.389 default I fury_of_elune Fluffy_Pillow 44.5/100: 45% astral_power starlord(2), torrent_of_elements, ignition_mages_fuse
2:06.506 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power fury_of_elune, starlord(2), torrent_of_elements, ignition_mages_fuse
2:07.625 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power fury_of_elune, starlord(3), starfall, torrent_of_elements, ignition_mages_fuse
2:09.256 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power fury_of_elune, starfall, torrent_of_elements, ignition_mages_fuse
2:11.032 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power fury_of_elune, starfall, ignition_mages_fuse(2)
2:12.737 default K starfall Fluffy_Pillow 70.0/100: 70% astral_power fury_of_elune, starfall, ignition_mages_fuse(2)
2:13.875 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power starlord, starfall, ignition_mages_fuse(3)
2:15.465 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power starlord, starfall, ignition_mages_fuse(3)
2:17.055 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power starlord, starfall, ignition_mages_fuse(3)
2:18.115 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power starlord(2), starfall, ignition_mages_fuse(4)
2:19.601 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power solar_empowerment, starlord(2), starfall, ignition_mages_fuse(4)
2:20.445 default O sunfire Fluffy_Pillow 24.5/100: 25% astral_power starlord(2), starfall, ignition_mages_fuse(4)
2:21.439 default P moonfire Fluffy_Pillow 28.0/100: 28% astral_power starlord(2), starfall, ignition_mages_fuse(5)
2:22.396 default P moonfire enemy3 31.5/100: 32% astral_power starlord(2), starfall, ignition_mages_fuse(5)
2:23.353 default P moonfire enemy2 35.5/100: 36% astral_power starlord(2), starfall, ignition_mages_fuse(5)
2:24.309 default P moonfire enemy4 39.0/100: 39% astral_power starlord(2), starfall, ignition_mages_fuse(5)
2:25.267 default P moonfire enemy7 42.5/100: 43% astral_power starlord(2), ignition_mages_fuse(5)
2:26.225 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power starlord(2)
2:27.975 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power solar_empowerment, starlord(2), overwhelming_power(25)
2:29.044 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power solar_empowerment, starlord(3), starfall, overwhelming_power(23)
2:29.933 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power starlord(3), starfall, overwhelming_power(23)
2:31.501 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power starlord(3), starfall, overwhelming_power(21)
2:33.080 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power starfall, overwhelming_power(19)
2:34.814 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power starfall, overwhelming_power(18)
2:35.976 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power starlord, starfall, overwhelming_power(17)
2:37.672 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power starlord, starfall, overwhelming_power(15)
2:39.377 default O sunfire Fluffy_Pillow 35.0/100: 35% astral_power solar_empowerment, starlord, starfall, overwhelming_power(13)
2:40.524 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power solar_empowerment, starlord, starfall, overwhelming_power(12)
2:41.502 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power lunar_empowerment, starlord, starfall, overwhelming_power(11)
2:42.973 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power starlord, overwhelming_power(10)
2:44.133 default P moonfire Fluffy_Pillow 11.0/100: 11% astral_power starlord(2), starfall, overwhelming_power(8)
2:45.267 default P moonfire enemy3 15.0/100: 15% astral_power starlord(2), starfall, overwhelming_power(7)
2:46.405 default P moonfire enemy5 18.5/100: 19% astral_power starlord(2), starfall, overwhelming_power(6)
2:47.548 default P moonfire enemy2 22.5/100: 23% astral_power starlord(2), starfall, overwhelming_power(5)
2:48.697 default P moonfire enemy6 26.0/100: 26% astral_power starlord(2), starfall, overwhelming_power(4)
2:49.849 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power starlord(2), starfall, overwhelming_power(3)
2:51.579 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power starlord(2), overwhelming_power
2:53.323 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power starlord(2)
2:54.491 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power starlord(3), starfall
2:56.194 default O sunfire Fluffy_Pillow 20.0/100: 20% astral_power starfall
2:57.432 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power starfall
2:59.286 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power starfall
3:01.142 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power starfall
3:02.380 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power starlord, starfall
3:04.181 default P moonfire enemy5 14.5/100: 14% astral_power starlord, starfall
3:05.383 default P moonfire enemy3 18.5/100: 19% astral_power starlord, starfall
3:06.588 default P moonfire enemy4 22.0/100: 22% astral_power starlord, starfall
3:07.790 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power starlord, starfall
3:09.593 default P moonfire enemy6 39.0/100: 39% astral_power starlord
3:10.796 default H celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, starlord
3:11.842 default E potion Fluffy_Pillow 83.5/100: 84% astral_power celestial_alignment, starlord
3:11.842 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power celestial_alignment, starlord, battle_potion_of_intellect
3:11.842 default I fury_of_elune Fluffy_Pillow 83.5/100: 84% astral_power berserking, celestial_alignment, starlord, battle_potion_of_intellect
3:12.793 default K starfall Fluffy_Pillow 87.0/100: 87% astral_power berserking, celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect
3:13.745 default P moonfire Fluffy_Pillow 42.5/100: 43% astral_power berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect
3:14.670 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect
3:15.594 default O sunfire Fluffy_Pillow 6.5/100: 7% astral_power berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:16.493 default P moonfire enemy7 15.0/100: 15% astral_power berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:17.393 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:18.290 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:19.637 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:20.537 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power berserking, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect
3:21.885 default K starfall Fluffy_Pillow 79.5/100: 80% astral_power berserking, celestial_alignment, starfall, battle_potion_of_intellect
3:22.863 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power berserking, celestial_alignment, starlord, starfall, battle_potion_of_intellect
3:23.814 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power berserking, celestial_alignment, lunar_empowerment, starlord, starfall, battle_potion_of_intellect
3:25.026 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, starlord, starfall, battle_potion_of_intellect
3:26.072 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:27.089 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power celestial_alignment, lunar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:28.383 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:29.399 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:30.921 default P moonfire enemy5 45.5/100: 46% astral_power starlord(2), starfall, battle_potion_of_intellect
3:32.089 default O sunfire Fluffy_Pillow 49.0/100: 49% astral_power starlord(2), starfall, battle_potion_of_intellect
3:33.257 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power starlord(2), battle_potion_of_intellect
3:34.427 default P moonfire Fluffy_Pillow 3.5/100: 4% astral_power starlord(3), starfall, battle_potion_of_intellect
3:35.564 default P moonfire enemy2 7.5/100: 8% astral_power starlord(3), starfall, battle_potion_of_intellect
3:36.700 default P moonfire enemy6 11.0/100: 11% astral_power starlord(3), starfall, battle_potion_of_intellect
3:37.838 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power starlord(3), starfall
3:39.541 default P moonfire enemy4 28.0/100: 28% astral_power starlord(3), starfall
3:40.679 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power starlord(3), starfall
3:42.380 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power
3:44.236 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power solar_empowerment
3:45.477 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power solar_empowerment, starlord, starfall
3:46.500 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power starlord, starfall
3:48.302 default P moonfire enemy5 31.0/100: 31% astral_power starlord, starfall
3:49.506 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power starlord, starfall
3:51.308 default O sunfire Fluffy_Pillow 48.0/100: 48% astral_power solar_empowerment, starlord, starfall
3:52.511 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power solar_empowerment, starlord
3:53.714 default P moonfire enemy6 27.5/100: 28% astral_power lucid_dreams, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(24)
3:54.786 default P moonfire Fluffy_Pillow 31.5/100: 32% astral_power lucid_dreams, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(23)
3:55.862 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power lucid_dreams, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(22)
3:56.780 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power lucid_dreams, starlord(2), starfall, torrent_of_elements, overwhelming_power(21)
3:58.402 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power lucid_dreams, starlord(2), starfall, torrent_of_elements, overwhelming_power(19)
3:59.493 default P moonfire enemy3 7.5/100: 8% astral_power lucid_dreams, starlord(3), starfall, torrent_of_elements, overwhelming_power(18)
4:00.558 default P moonfire enemy4 11.0/100: 11% astral_power starlord(3), starfall, torrent_of_elements, overwhelming_power(17)
4:01.627 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power starlord(3), starfall, torrent_of_elements, overwhelming_power(16)
4:03.235 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power starlord(3), starfall, torrent_of_elements, overwhelming_power(14)
4:04.852 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power starfall, torrent_of_elements, overwhelming_power(13)
4:06.620 default G use_items Fluffy_Pillow 54.0/100: 54% astral_power torrent_of_elements, overwhelming_power(11)
4:06.620 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power torrent_of_elements, overwhelming_power(11), ignition_mages_fuse
4:07.762 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power starlord, starfall, torrent_of_elements, overwhelming_power(10), ignition_mages_fuse
4:09.427 default O sunfire Fluffy_Pillow 18.0/100: 18% astral_power starlord, starfall, overwhelming_power(8), ignition_mages_fuse
4:10.546 default P moonfire enemy5 22.0/100: 22% astral_power starlord, starfall, overwhelming_power(7), ignition_mages_fuse
4:11.667 default I fury_of_elune Fluffy_Pillow 25.5/100: 26% astral_power starlord, starfall, overwhelming_power(6), ignition_mages_fuse(2)
4:12.925 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power fury_of_elune, starlord, starfall, overwhelming_power(5), ignition_mages_fuse(2)
4:14.552 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power fury_of_elune, starlord, starfall, overwhelming_power(3), ignition_mages_fuse(2)
4:15.645 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power fury_of_elune, starlord(2), starfall, overwhelming_power(2), ignition_mages_fuse(3)
4:17.181 default P moonfire Fluffy_Pillow 28.0/100: 28% astral_power fury_of_elune, starlord(2), starfall, ignition_mages_fuse(3)
4:18.213 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power fury_of_elune, starlord(2), starfall, ignition_mages_fuse(3)
4:19.759 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power fury_of_elune, solar_empowerment, starlord(2), starfall, ignition_mages_fuse(4)
4:20.751 default P moonfire enemy3 10.5/100: 11% astral_power solar_empowerment, starlord(3), starfall, ignition_mages_fuse(4)
4:21.718 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power solar_empowerment, starlord(3), starfall, ignition_mages_fuse(4)
4:22.541 default P moonfire enemy4 23.0/100: 23% astral_power lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(4)
4:23.507 default P moonfire enemy6 26.5/100: 27% astral_power lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(5)
4:24.439 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(5)
4:25.626 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power starlord(3), starfall, ignition_mages_fuse(5)
4:27.021 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power starfall
4:28.260 default O sunfire Fluffy_Pillow 6.5/100: 7% astral_power starlord, starfall
4:29.462 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power starlord, starfall
4:31.264 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power starlord, starfall
4:33.064 default P moonfire enemy2 37.0/100: 37% astral_power starlord, starfall
4:34.264 default P moonfire enemy5 40.5/100: 41% astral_power starlord, starfall
4:35.465 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power starlord
4:37.265 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power starlord, conch_of_dark_whispers
4:38.468 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power starlord(2), starfall, conch_of_dark_whispers
4:40.219 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power starlord(2), starfall, conch_of_dark_whispers
4:41.968 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power solar_empowerment, starlord(2), starfall, conch_of_dark_whispers
4:42.962 default P moonfire enemy7 43.5/100: 44% astral_power starlord(2), starfall, conch_of_dark_whispers
4:44.129 default O sunfire Fluffy_Pillow 47.0/100: 47% astral_power starlord(2), starfall, conch_of_dark_whispers
4:45.299 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power starlord(2), conch_of_dark_whispers
4:46.466 default P moonfire enemy3 1.5/100: 2% astral_power starlord(3), starfall, conch_of_dark_whispers
4:47.602 default P moonfire enemy4 5.5/100: 6% astral_power starfall, conch_of_dark_whispers
4:48.842 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power starfall, conch_of_dark_whispers
4:50.699 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power starfall, conch_of_dark_whispers
4:52.552 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power solar_empowerment, starfall
4:53.603 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power
4:55.457 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power
4:56.695 default P moonfire Fluffy_Pillow 8.5/100: 9% astral_power starlord, starfall
4:57.899 default P moonfire enemy5 12.5/100: 13% astral_power starlord, starfall
4:59.102 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power starlord, starfall
5:00.905 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power starlord, starfall, overwhelming_power(24)
5:02.557 default O sunfire Fluffy_Pillow 42.5/100: 43% astral_power starlord, starfall, overwhelming_power(22)
5:03.669 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power starlord, overwhelming_power(21)
5:05.340 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power starlord, overwhelming_power(19)
5:06.462 default P moonfire enemy6 10.0/100: 10% astral_power starlord(2), starfall, overwhelming_power(18)
5:07.556 default P moonfire enemy3 14.0/100: 14% astral_power starlord(2), starfall, overwhelming_power(17)
5:08.654 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power starlord(2), starfall, overwhelming_power(16)
5:10.305 default P moonfire enemy2 30.5/100: 31% astral_power solar_empowerment, starlord(2), starfall, overwhelming_power(14)
5:11.416 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power solar_empowerment, starlord(2), starfall, overwhelming_power(13)
5:12.364 default I fury_of_elune Fluffy_Pillow 43.0/100: 43% astral_power starlord(2), starfall, overwhelming_power(12)
5:13.481 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power fury_of_elune, starlord(2), overwhelming_power(11)
5:15.163 default K starfall Fluffy_Pillow 69.5/100: 70% astral_power fury_of_elune, starlord(2), overwhelming_power(9)
5:16.292 default P moonfire enemy5 25.0/100: 25% astral_power fury_of_elune, starfall, overwhelming_power(8)
5:17.495 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power fury_of_elune, starfall, overwhelming_power(7)
5:19.304 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power fury_of_elune, starfall, overwhelming_power(5)
5:20.518 default O sunfire Fluffy_Pillow 15.5/100: 16% astral_power starlord, starfall, overwhelming_power(4)
5:21.702 default P moonfire enemy4 19.0/100: 19% astral_power starlord, starfall, overwhelming_power(3)
5:22.892 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power starlord, starfall, torrent_of_elements, overwhelming_power(2)
5:24.680 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power starlord, starfall, torrent_of_elements
5:26.481 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power starlord, starfall, torrent_of_elements
5:28.283 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power starlord, torrent_of_elements
5:29.485 default P moonfire Fluffy_Pillow 13.5/100: 14% astral_power starlord(2), starfall, torrent_of_elements
5:30.653 default P moonfire enemy6 17.0/100: 17% astral_power starlord(2), starfall, torrent_of_elements
5:31.821 default P moonfire enemy7 21.0/100: 21% astral_power starlord(2), starfall, torrent_of_elements
5:32.991 default P moonfire enemy3 24.5/100: 25% astral_power starlord(2), starfall, torrent_of_elements
5:34.160 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power starlord(2), starfall, torrent_of_elements
5:35.910 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power starlord(2), starfall, torrent_of_elements
5:37.660 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power starlord(2)
5:38.829 default O sunfire Fluffy_Pillow 5.5/100: 6% astral_power starlord(3), starfall
5:39.966 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power starfall
5:41.821 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power starfall
5:43.677 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power starfall

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 100571 dps, 20204 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
100571.0 100571.0 93.3 / 0.093% 10012.1 / 10.0% 14846.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 100571
Fury of Elune 5863 5.8% 5.3 61.16sec 332101 324483 Direct 890.9 1661 3315 1967 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 890.92 136.85 0.00 1.0235 0.3046 1752530.97 1752530.97 0.00 37222.95 324482.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 725.91 81.48% 1660.65 1457 1987 1662.64 1590 1807 1205506 1205506 0.00
crit 165.01 18.52% 3315.21 2915 3974 3318.57 3118 3660 547025 547025 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 285 (1137) 0.3% (1.1%) 7.9 34.10sec 43388 0 Direct 7.9 9124 18263 10863 19.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 7.85 0.00 0.00 0.0000 0.0000 85320.63 85320.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 80.97% 9123.56 8921 9813 9121.25 0 9813 58026 58026 0.00
crit 1.49 19.03% 18263.19 17842 19626 14217.32 0 19626 27295 27295 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 853 0.8% 7.9 34.10sec 32525 0 Direct 55.0 3910 7824 4647 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 54.98 0.00 0.00 0.0000 0.0000 255468.12 255468.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.64 81.19% 3910.50 3823 4206 3910.65 3823 4206 174570 174570 0.00
crit 10.34 18.81% 7823.68 7646 8411 7815.83 0 8411 80898 80898 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11046 11.0% 82.9 3.55sec 39966 25134 Direct 580.1 4813 9606 5709 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.87 580.12 0.00 0.00 1.5901 0.0000 3312095.74 3312095.74 0.00 25133.71 25133.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.64 81.30% 4813.17 3345 24211 4817.52 4446 5398 2270081 2270081 0.00
crit 108.48 18.70% 9606.17 6689 48422 9618.20 7676 11806 1042014 1042014 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21095 21.0% 64.3 4.59sec 98199 90650 Direct 128.7 3475 6950 4123 18.6%  
Periodic 1494.7 3264 6521 3872 18.7% 689.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.33 128.67 1494.71 1494.71 1.0833 1.3840 6317501.25 6317501.25 0.00 2954.27 90650.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.68 81.36% 3475.45 3280 4472 3477.09 3369 3629 363832 363832 0.00
crit 23.98 18.64% 6949.80 6559 8943 6953.00 6559 7580 166684 166684 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1215.8 81.34% 3263.60 2 4163 3265.24 3187 3395 3967789 3967789 0.00
crit 279.0 18.66% 6521.36 14 8327 6524.46 6306 6841 1819197 1819197 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 4997 5.0% 16.1 17.76sec 93156 0 Direct 112.4 11226 22457 13309 18.5%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.06 112.45 0.00 0.00 0.0000 0.0000 1496436.80 1496436.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.60 81.46% 11225.94 10972 12069 11226.86 10972 11817 1028345 1028345 0.00
crit 20.84 18.54% 22457.10 21944 24139 22458.79 21944 23825 468092 468092 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Solar Wrath 1171 (4206) 1.2% (4.2%) 31.5 9.13sec 39880 45527 Direct 32.4 9072 18135 10749 18.5%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.54 32.41 0.00 0.00 0.8760 0.0000 348410.61 348410.61 0.00 45526.66 45526.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.42 81.50% 9071.90 7949 10838 9083.49 8563 10097 239636 239636 0.00
crit 6.00 18.50% 18134.74 15898 21676 18123.84 0 21676 108775 108775 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3035 3.0% 17.4 16.61sec 52396 0 Direct 121.5 7486 0 7486 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.36 121.49 0.00 0.00 0.0000 0.0000 909354.32 909354.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.49 100.00% 7485.66 5962 16257 7493.42 6100 10245 909354 909354 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starfall 29591 29.4% 39.5 7.62sec 224632 208738 Periodic 2464.6 3031 6059 3596 18.6% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.45 0.00 0.00 2464.59 1.0762 0.0000 8861960.16 8861960.16 0.00 208737.73 208737.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2005.0 81.35% 3031.13 2838 3869 3032.64 2961 3154 6077456 6077456 0.00
crit 459.6 18.65% 6058.53 5675 7738 6061.43 5878 6344 2784505 2784505 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 309 0.3% 1.4 267.55sec 66228 77301 Direct 1.2 62827 125361 74881 19.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.38 1.22 0.00 0.00 0.8574 0.0000 91292.64 91292.64 0.00 77301.13 77301.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.98 80.69% 62827.00 51347 69612 53081.36 0 69612 61788 61788 0.00
crit 0.24 19.31% 125361.35 102695 139223 28392.75 0 139223 29505 29505 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2951 2.9% 45.0 4.61sec 19407 0 Direct 45.0 16381 32758 19406 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 0.0000 0.0000 872925.41 872925.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.67 81.53% 16380.87 16021 17623 16381.29 16021 17623 600723 600723 0.00
crit 8.31 18.47% 32758.19 32042 35246 32754.80 32042 35246 272202 272202 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19375 19.3% 18.5 16.38sec 313809 298987 Direct 18.5 4441 8882 5267 18.6%  
Periodic 1507.4 3189 6374 3784 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.49 18.49 1507.42 1507.42 1.0496 1.3832 5801552.33 5801552.33 0.00 2756.72 298987.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.05 81.39% 4440.78 4112 5607 4443.43 4179 4774 66819 66819 0.00
crit 3.44 18.61% 8882.48 8225 11214 8696.92 0 11214 30567 30567 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1225.8 81.32% 3189.01 101 4065 3190.62 3111 3319 3909135 3909135 0.00
crit 281.6 18.68% 6373.87 295 8130 6376.74 6170 6709 1795032 1795032 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.09sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.86sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9086 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 264.1sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.36%
  • arcanic_pulsar_2:0.81%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.1sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.9sec 183.9sec 13.52% 19.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.2sec 46.1sec 23.39% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.2sec 61.2sec 13.91% 0.00% 83.3(83.3) 5.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.01% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.85%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.2 1.6 47.4sec 37.2sec 9.30% 8.90% 0.1(0.1) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.97%
  • lunar_empowerment_2:1.77%
  • lunar_empowerment_3:0.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.4 3.3 65.8sec 35.1sec 46.36% 0.00% 3.3(44.9) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.34%
  • overwhelming_power_2:1.38%
  • overwhelming_power_3:1.42%
  • overwhelming_power_4:1.46%
  • overwhelming_power_5:1.49%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.62%
  • overwhelming_power_9:1.67%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.76%
  • overwhelming_power_12:1.81%
  • overwhelming_power_13:1.86%
  • overwhelming_power_14:1.91%
  • overwhelming_power_15:1.97%
  • overwhelming_power_16:2.03%
  • overwhelming_power_17:2.09%
  • overwhelming_power_18:2.15%
  • overwhelming_power_19:2.21%
  • overwhelming_power_20:2.28%
  • overwhelming_power_21:2.34%
  • overwhelming_power_22:2.41%
  • overwhelming_power_23:2.48%
  • overwhelming_power_24:2.55%
  • overwhelming_power_25:1.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.8 0.1 16.4sec 16.3sec 12.71% 53.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.67%
  • solar_empowerment_2:0.04%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.9 18.6 14.6sec 7.6sec 87.98% 0.00% 18.6(18.6) 20.2

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:87.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.6sec 7.4sec 88.23% 85.50% 1.2(1.2) 11.5

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.86%
  • starlord_2:31.06%
  • starlord_3:24.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.4sec 23.72% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.72%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starfall Astral Power 39.5 1972.6 50.0 50.0 4492.5
starsurge Astral Power 1.4 55.1 40.0 40.0 1656.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.54 260.27 (13.07%) 8.00 0.04 0.02%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.34 208.34 (10.46%) 2.50 0.00 0.00%
sunfire Astral Power 18.49 55.46 (2.78%) 3.00 0.00 0.00%
moonfire Astral Power 64.34 193.01 (9.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.88 994.52 (49.93%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.17 (10.05%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.76
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.90 0.00 63.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data purification protocol Damage Per Second
Count 2851
Mean 100571.04
Minimum 93239.19
Maximum 109069.87
Spread ( max - min ) 15830.69
Range [ ( max - min ) / 2 * 100% ] 7.87%
Standard Deviation 2540.6928
5th Percentile 96624.06
95th Percentile 104916.60
( 95th Percentile - 5th Percentile ) 8292.54
Mean Distribution
Standard Deviation 47.5832
95.00% Confidence Intervall ( 100477.78 - 100664.30 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2452
0.1 Scale Factor Error with Delta=300 55105
0.05 Scale Factor Error with Delta=300 220419
0.01 Scale Factor Error with Delta=300 5510462
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 2851
Mean 20203.98
Minimum 18154.46
Maximum 23036.78
Spread ( max - min ) 4882.31
Range [ ( max - min ) / 2 * 100% ] 12.08%
Standard Deviation 773.4831
5th Percentile 19029.98
95th Percentile 21511.49
( 95th Percentile - 5th Percentile ) 2481.51
Mean Distribution
Standard Deviation 14.4861
95.00% Confidence Intervall ( 20175.59 - 20232.37 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5631
0.1 Scale Factor Error with Delta=300 5108
0.05 Scale Factor Error with Delta=300 20429
0.01 Scale Factor Error with Delta=300 510723
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 2851
Mean 100571.04
Minimum 93239.19
Maximum 109069.87
Spread ( max - min ) 15830.69
Range [ ( max - min ) / 2 * 100% ] 7.87%
Damage
Sample Data purification protocol Damage
Count 2851
Mean 30104848.97
Minimum 23266180.81
Maximum 36580266.86
Spread ( max - min ) 13314086.05
Range [ ( max - min ) / 2 * 100% ] 22.11%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.39 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.45 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.38 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.34 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.31 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.08 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.02 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.51 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.60 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.07 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKRQMQQKQQQQQQQJKPKPPPOPQQQKQQRQQKPOPPPPIPKRQKQQQKOQPQQPKPPPQQOQKQQPQKPPQPPOPQKQQQQGIKQPRKOPPPQKQQQQQQKOQPKPPQPPQQKQQORQKQPPPQPKPRQOQHEFIKRKRQRKPRPRPRKOPRQMPQQKQQQKPPQPOPPQKRQQQKQRPGOPPQIKPPQKQQQKQOQQPKPPRQQPKQQOQQKQRPQPKPQPOPQQKQQQIKPPOPQKPPRQQKQQQKOPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.163 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:03.088 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:04.013 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:04.938 default P moonfire enemy7 31.0/100: 31% astral_power bloodlust, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:05.864 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:07.252 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect
0:08.058 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:08.058 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
0:08.058 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.812 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.567 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.324 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:11.078 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:11.832 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:12.827 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.581 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.533 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.288 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.041 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.794 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.548 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.301 default P moonfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.056 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.810 default P moonfire enemy2 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.563 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.317 default P moonfire enemy3 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.070 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.825 default P moonfire enemy4 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.579 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, conch_of_dark_whispers, ignition_mages_fuse(4)
0:24.333 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.087 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.841 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.658 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
0:27.414 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(2), starfall, conch_of_dark_whispers, ignition_mages_fuse(5)
0:28.353 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers
0:29.500 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
0:30.400 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
0:31.710 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
0:33.019 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(24), conch_of_dark_whispers
0:34.220 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(23), conch_of_dark_whispers
0:35.427 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(22), conch_of_dark_whispers
0:36.638 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(21)
0:37.854 default Q lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(20)
0:39.073 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(18)
0:39.073 default K starfall Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar, overwhelming_power(18)
0:39.968 default P moonfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, starlord, starfall, overwhelming_power(18)
0:40.838 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar, starlord, starfall, overwhelming_power(17)
0:41.709 default P moonfire enemy2 0.5/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16)
0:42.812 default P moonfire enemy3 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15)
0:43.917 default P moonfire enemy4 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(14)
0:45.026 default O sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(12)
0:46.143 default P moonfire enemy6 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(11)
0:47.264 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(10)
0:48.953 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(9)
0:50.647 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(7)
0:52.354 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(5)
0:53.502 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(4)
0:55.180 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(23)
0:56.748 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(22)
0:57.643 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(21)
0:58.985 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(20)
1:00.569 default K starfall Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(18)
1:01.730 default P moonfire enemy5 21.0/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(17)
1:02.859 default O sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(16)
1:03.993 default P moonfire enemy3 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(15)
1:05.131 default P moonfire enemy2 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(13)
1:06.278 default P moonfire enemy7 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(12)
1:07.428 default P moonfire enemy6 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(11)
1:08.580 default I fury_of_elune Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(10)
1:09.739 default P moonfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, overwhelming_power(9)
1:10.900 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, overwhelming_power(8)
1:12.067 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, overwhelming_power(6)
1:13.041 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(5)
1:14.759 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(4)
1:15.911 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(3)
1:17.595 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power
1:19.293 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(3), starfall
1:20.994 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starfall
1:22.234 default O sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord, starfall
1:23.435 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord, starfall
1:25.236 default P moonfire enemy4 18.5/100: 19% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:26.437 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:28.238 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
1:30.040 default P moonfire enemy3 49.0/100: 49% astral_power arcanic_pulsar, starlord, torrent_of_elements, conch_of_dark_whispers
1:31.242 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord, torrent_of_elements, conch_of_dark_whispers
1:32.444 default P moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:33.614 default P moonfire enemy5 7.0/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:34.782 default P moonfire enemy6 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:35.951 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:37.702 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
1:39.454 default O sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starlord(2), torrent_of_elements
1:40.622 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), torrent_of_elements
1:42.373 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar
1:43.611 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24)
1:45.264 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22), conch_of_dark_whispers
1:46.929 default P moonfire enemy4 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21), conch_of_dark_whispers
1:48.044 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), conch_of_dark_whispers
1:49.727 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18), conch_of_dark_whispers
1:50.853 default P moonfire enemy5 2.5/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17), conch_of_dark_whispers
1:51.953 default P moonfire enemy6 6.5/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), conch_of_dark_whispers
1:53.055 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(14), conch_of_dark_whispers
1:54.718 default P moonfire enemy7 23.0/100: 23% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), conch_of_dark_whispers
1:55.833 default P moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12), conch_of_dark_whispers
1:56.953 default O sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), conch_of_dark_whispers
1:58.076 default P moonfire enemy2 34.5/100: 35% astral_power arcanic_pulsar, starlord(2), overwhelming_power(9), conch_of_dark_whispers
1:59.206 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), overwhelming_power(8), conch_of_dark_whispers
2:00.905 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord(2), overwhelming_power(7), conch_of_dark_whispers
2:02.042 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
2:03.713 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
2:05.543 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
2:07.384 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
2:09.242 default G use_items Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, torrent_of_elements
2:09.242 default I fury_of_elune Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, torrent_of_elements, ignition_mages_fuse
2:10.428 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, fury_of_elune, torrent_of_elements, ignition_mages_fuse
2:11.615 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, ignition_mages_fuse
2:13.341 default P moonfire enemy5 39.5/100: 40% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, ignition_mages_fuse(2)
2:14.446 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, ignition_mages_fuse(2)
2:15.387 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, ignition_mages_fuse(2)
2:16.493 default O sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, ignition_mages_fuse(2)
2:17.568 default P moonfire enemy4 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(3)
2:18.599 default P moonfire enemy6 30.0/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(3)
2:19.630 default P moonfire enemy2 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(3)
2:20.662 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(3)
2:22.209 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse(4)
2:23.203 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(4)
2:24.651 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(4)
2:26.098 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(5)
2:27.492 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(5)
2:28.887 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord(3), starfall, ignition_mages_fuse(5)
2:30.282 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, starlord(3)
2:31.984 default K starfall Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, overwhelming_power(25)
2:33.116 default O sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23)
2:34.223 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22)
2:35.888 default P moonfire enemy5 46.5/100: 47% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21)
2:37.002 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19)
2:38.125 default P moonfire enemy7 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18)
2:39.221 default P moonfire enemy4 5.0/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17)
2:40.320 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16)
2:41.971 default P moonfire enemy2 21.5/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15)
2:43.078 default P moonfire enemy3 25.5/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13)
2:44.193 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12)
2:45.869 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord(2), overwhelming_power(11)
2:47.550 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord(2), overwhelming_power(9)
2:48.680 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(8)
2:50.333 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(6)
2:51.999 default O sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(5)
2:53.215 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(3)
2:54.256 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starfall, overwhelming_power(2)
2:56.099 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar
2:57.337 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord, starfall
2:59.139 default P moonfire enemy6 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24)
3:00.242 default P moonfire enemy7 26.0/100: 26% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23)
3:01.350 default P moonfire enemy4 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22)
3:02.461 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21)
3:04.131 default P moonfire enemy5 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(19)
3:05.253 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(18)
3:06.381 default P moonfire enemy2 1.0/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(17)
3:07.479 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(16)
3:08.418 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15)
3:10.076 default O sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13)
3:11.191 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12)
3:12.868 default H celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(11)
3:13.845 default E potion Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(10)
3:13.845 default F berserking Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:13.845 default I fury_of_elune Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:14.738 default K starfall Fluffy_Pillow 87.0/100: 87% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
3:15.632 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:16.507 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starfall, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:17.462 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord, starfall, overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:18.392 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord, starfall, overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:19.582 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(4), conch_of_dark_whispers, battle_potion_of_intellect
3:20.519 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord, starfall, overwhelming_power(3), conch_of_dark_whispers, battle_potion_of_intellect
3:21.460 default P moonfire Fluffy_Pillow 12.5/100: 13% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), starfall, overwhelming_power(2), conch_of_dark_whispers, battle_potion_of_intellect
3:22.376 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power, conch_of_dark_whispers, battle_potion_of_intellect
3:23.298 default P moonfire enemy3 27.5/100: 28% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:24.224 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:25.150 default P moonfire enemy7 39.5/100: 40% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:26.075 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:27.092 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:28.107 default O sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:29.095 default P moonfire enemy5 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, conch_of_dark_whispers, battle_potion_of_intellect
3:30.085 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect
3:31.073 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect
3:32.332 default M sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, battle_potion_of_intellect
3:33.320 default P moonfire enemy2 35.0/100: 35% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:34.457 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:36.159 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(3), battle_potion_of_intellect
3:37.863 default K starfall Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, battle_potion_of_intellect
3:39.103 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall
3:40.905 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord, starfall
3:42.707 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord, starfall
3:44.508 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord, starfall
3:45.710 default P moonfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord(2), starfall
3:46.878 default P moonfire enemy7 10.0/100: 10% astral_power arcanic_pulsar, starlord(2), starfall
3:48.045 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall
3:49.796 default P moonfire enemy2 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall
3:50.964 default O sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord(2), starfall
3:52.134 default P moonfire enemy4 34.5/100: 35% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:53.304 default P moonfire enemy6 38.5/100: 39% astral_power arcanic_pulsar, starlord(2), conch_of_dark_whispers
3:54.474 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), conch_of_dark_whispers
3:56.224 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord(2), conch_of_dark_whispers
3:57.392 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers
3:58.359 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
4:00.215 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
4:02.069 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
4:03.924 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, starfall, torrent_of_elements, conch_of_dark_whispers
4:05.163 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
4:06.964 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements
4:07.988 default P moonfire enemy3 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
4:09.190 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
4:09.190 default O sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse
4:10.343 default P moonfire enemy5 34.5/100: 35% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse
4:11.494 default P moonfire enemy2 38.5/100: 39% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse
4:12.646 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord, torrent_of_elements, ignition_mages_fuse
4:14.372 default I fury_of_elune Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(2)
4:15.391 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, fury_of_elune, starlord, torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(2)
4:16.414 default P moonfire enemy6 16.5/100: 17% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(2)
4:17.411 default P moonfire enemy7 25.5/100: 26% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(3)
4:18.376 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(3)
4:19.825 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(3)
4:20.797 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(18), ignition_mages_fuse(3)
4:22.216 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, overwhelming_power(16), ignition_mages_fuse(4)
4:23.593 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(15), ignition_mages_fuse(4)
4:24.975 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starfall, overwhelming_power(14), ignition_mages_fuse(4)
4:25.982 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(25), ignition_mages_fuse(5)
4:27.353 default O sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), ignition_mages_fuse(5)
4:28.273 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(22), ignition_mages_fuse(5)
4:29.655 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24)
4:31.309 default P moonfire enemy3 49.5/100: 50% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(22)
4:32.419 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(21)
4:33.533 default P moonfire enemy2 4.0/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(20)
4:34.621 default P moonfire enemy5 8.0/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(19)
4:35.714 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(18)
4:36.646 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17)
4:38.292 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24)
4:39.899 default P moonfire enemy4 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23)
4:40.977 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord(2), overwhelming_power(22)
4:42.056 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(20)
4:43.639 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(19)
4:45.228 default O sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starfall, overwhelming_power(17)
4:46.393 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starfall, overwhelming_power(16)
4:48.142 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starfall, overwhelming_power(14)
4:49.904 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, overwhelming_power(13)
4:51.085 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11)
4:52.815 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(10)
4:53.801 default P moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9)
4:54.964 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(8)
4:56.713 default P moonfire enemy5 46.5/100: 47% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(6), conch_of_dark_whispers
4:57.888 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(5), conch_of_dark_whispers
4:59.069 default P moonfire enemy6 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(3), conch_of_dark_whispers
5:00.226 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(2), conch_of_dark_whispers
5:01.964 default P moonfire enemy3 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power, conch_of_dark_whispers
5:03.128 default O sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:04.296 default P moonfire enemy4 25.5/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:05.465 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
5:07.216 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord(2), conch_of_dark_whispers
5:08.967 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, starlord(2), conch_of_dark_whispers
5:10.136 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
5:11.991 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starfall
5:13.846 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starfall
5:15.702 default I fury_of_elune Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, starfall
5:16.939 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, starfall
5:18.177 default P moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall
5:19.378 default P moonfire enemy6 19.0/100: 19% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall
5:20.580 default O sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall
5:21.783 default P moonfire enemy5 39.5/100: 40% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall
5:22.988 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall
5:24.789 default K starfall Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
5:25.991 default P moonfire enemy2 17.0/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:27.161 default P moonfire enemy7 21.0/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:28.330 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:29.324 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall
5:31.074 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall
5:32.825 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starlord(2)
5:33.995 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall
5:35.698 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, starlord(3), starfall
5:37.401 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starfall
5:39.256 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starfall
5:40.494 default O sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, starlord, starfall
5:41.697 default P moonfire enemy6 4.5/100: 5% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
5:42.900 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 95622 dps, 19507 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
95621.9 95621.9 83.8 / 0.088% 8828.0 / 9.2% 14111.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 95622
Fury of Elune 5867 6.1% 5.3 61.17sec 332372 324747 Direct 891.4 1660 3316 1968 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 891.41 136.89 0.00 1.0235 0.3045 1753958.13 1753958.13 0.00 37255.64 324746.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 725.67 81.41% 1659.78 1457 1987 1661.71 1587 1820 1204435 1204435 0.00
crit 165.74 18.59% 3315.58 2915 3974 3318.97 3093 3708 549523 549523 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 284 (1136) 0.3% (1.2%) 7.9 34.83sec 43345 0 Direct 7.9 9128 18263 10839 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 7.86 0.00 0.00 0.0000 0.0000 85176.07 85176.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 81.26% 9128.17 8921 9813 9121.51 0 9813 58280 58280 0.00
crit 1.47 18.74% 18262.59 17842 19626 14134.39 0 19626 26896 26896 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 852 0.9% 7.9 34.83sec 32505 0 Direct 55.0 3912 7825 4643 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 55.00 0.00 0.00 0.0000 0.0000 255396.78 255396.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.72 81.31% 3912.28 3823 4206 3912.28 3823 4177 174970 174970 0.00
crit 10.28 18.69% 7825.06 7646 8411 7822.15 0 8411 80427 80427 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11052 11.6% 82.8 3.56sec 39996 25160 Direct 579.9 4815 9617 5714 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.85 579.94 0.00 0.00 1.5897 0.0000 3313607.46 3313607.46 0.00 25159.70 25159.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.44 81.29% 4815.39 3345 24211 4819.78 4381 5282 2270137 2270137 0.00
crit 108.50 18.71% 9616.75 6689 48422 9631.02 7764 12091 1043470 1043470 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21104 22.1% 64.3 4.59sec 98222 90636 Direct 128.7 3475 6948 4122 18.6%  
Periodic 1494.9 3263 6522 3873 18.7% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.35 128.69 1494.86 1494.86 1.0837 1.3840 6320234.99 6320234.99 0.00 2955.29 90636.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.73 81.38% 3474.87 3280 4472 3476.49 3359 3649 363915 363915 0.00
crit 23.97 18.62% 6948.08 6559 8943 6950.84 6585 7613 166517 166517 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1215.0 81.28% 3262.91 2 4163 3264.50 3188 3395 3964448 3964448 0.00
crit 279.9 18.72% 6522.43 16 8327 6525.26 6326 6866 1825354 1825354 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1171 (4210) 1.2% (4.4%) 31.6 9.00sec 39862 45510 Direct 32.5 9069 18137 10742 18.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.58 32.46 0.00 0.00 0.8759 0.0000 348686.83 348686.83 0.00 45510.28 45510.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.48 81.56% 9068.77 7949 10838 9079.46 8492 9720 240112 240112 0.00
crit 5.99 18.44% 18136.55 15898 21676 18121.85 0 21676 108575 108575 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3038 3.2% 17.4 16.35sec 52356 0 Direct 121.7 7480 0 7480 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.39 121.71 0.00 0.00 0.0000 0.0000 910309.59 910309.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.71 100.00% 7480.36 5962 16257 7484.43 6092 9721 910310 910310 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6557.86
  • base_dd_max:6557.86
  • base_dd_mult:1.00
 
Starfall 29602 31.0% 39.5 7.61sec 224703 208829 Periodic 2465.1 3031 6059 3596 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.45 0.00 0.00 2465.07 1.0760 0.0000 8865012.38 8865012.38 0.00 208829.29 208829.29
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2004.9 81.33% 3030.95 2838 3869 3032.41 2962 3161 6076915 6076915 0.00
crit 460.1 18.67% 6059.39 5675 7738 6062.08 5880 6357 2788097 2788097 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 310 0.3% 1.4 276.53sec 65767 76457 Direct 1.2 62682 125324 74515 18.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.23 0.00 0.00 0.8605 0.0000 91671.84 91671.84 0.00 76456.91 76456.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.00 81.13% 62681.60 51347 69612 53629.71 0 69612 62573 62573 0.00
crit 0.23 18.87% 125323.95 102695 139223 28050.33 0 139223 29099 29099 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2960 3.1% 45.0 4.59sec 19446 0 Direct 45.0 16377 32772 19445 18.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.03 45.03 0.00 0.00 0.0000 0.0000 875547.97 875547.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.60 81.29% 16377.00 16021 17623 16377.73 16021 17623 599397 599397 0.00
crit 8.43 18.71% 32772.43 32042 35246 32771.52 32042 35246 276151 276151 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19382 20.3% 18.5 16.39sec 313768 298900 Direct 18.5 4441 8883 5264 18.5%  
Periodic 1507.5 3188 6375 3785 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.50 18.50 1507.52 1507.52 1.0498 1.3832 5803447.53 5803447.53 0.00 2757.56 298900.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.07 81.46% 4440.61 4112 5607 4443.17 4194 4744 66903 66903 0.00
crit 3.43 18.54% 8883.07 8225 11214 8684.24 0 11214 30466 30466 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1225.2 81.27% 3188.40 24 4065 3189.93 3115 3318 3906470 3906470 0.00
crit 282.3 18.73% 6374.54 671 8130 6377.45 6165 6763 1799607 1799607 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.12sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.90sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9082 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 268.3sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.50%
  • arcanic_pulsar_2:0.68%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.1sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.9sec 183.9sec 13.52% 19.13% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.7sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.2sec 61.2sec 13.91% 0.00% 83.3(83.3) 5.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.00% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 47.0sec 36.9sec 9.39% 9.00% 0.1(0.1) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:7.01%
  • lunar_empowerment_2:1.82%
  • lunar_empowerment_3:0.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.3 65.9sec 35.1sec 46.56% 0.00% 3.3(45.1) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.35%
  • overwhelming_power_2:1.39%
  • overwhelming_power_3:1.43%
  • overwhelming_power_4:1.46%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.63%
  • overwhelming_power_9:1.68%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.77%
  • overwhelming_power_12:1.82%
  • overwhelming_power_13:1.87%
  • overwhelming_power_14:1.93%
  • overwhelming_power_15:1.98%
  • overwhelming_power_16:2.04%
  • overwhelming_power_17:2.09%
  • overwhelming_power_18:2.15%
  • overwhelming_power_19:2.21%
  • overwhelming_power_20:2.28%
  • overwhelming_power_21:2.35%
  • overwhelming_power_22:2.42%
  • overwhelming_power_23:2.50%
  • overwhelming_power_24:2.56%
  • overwhelming_power_25:1.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.9 0.1 16.4sec 16.3sec 12.80% 53.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.76%
  • solar_empowerment_2:0.04%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.8 18.6 14.6sec 7.6sec 88.02% 0.00% 18.6(18.6) 20.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.7sec 7.4sec 88.14% 85.44% 1.2(1.2) 11.5

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.89%
  • starlord_2:30.95%
  • starlord_3:24.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.8sec 45.8sec 23.54% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.54%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starfall Astral Power 39.5 1972.6 50.0 50.0 4494.0
starsurge Astral Power 1.4 55.8 40.0 40.0 1644.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.58 260.64 (13.09%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.33 208.33 (10.46%) 2.50 0.00 0.00%
sunfire Astral Power 18.50 55.49 (2.79%) 3.00 0.00 0.00%
moonfire Astral Power 64.35 193.04 (9.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.85 994.21 (49.91%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.17 (10.05%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.76
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.05 0.50 58.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data ripple in space Damage Per Second
Count 2851
Mean 95621.87
Minimum 89507.30
Maximum 104396.17
Spread ( max - min ) 14888.88
Range [ ( max - min ) / 2 * 100% ] 7.79%
Standard Deviation 2282.6268
5th Percentile 91977.87
95th Percentile 99489.08
( 95th Percentile - 5th Percentile ) 7511.21
Mean Distribution
Standard Deviation 42.7500
95.00% Confidence Intervall ( 95538.09 - 95705.66 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2190
0.1 Scale Factor Error with Delta=300 44479
0.05 Scale Factor Error with Delta=300 177916
0.01 Scale Factor Error with Delta=300 4447885
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 2851
Mean 19507.06
Minimum 17662.70
Maximum 21998.02
Spread ( max - min ) 4335.33
Range [ ( max - min ) / 2 * 100% ] 11.11%
Standard Deviation 742.1123
5th Percentile 18364.74
95th Percentile 20755.47
( 95th Percentile - 5th Percentile ) 2390.73
Mean Distribution
Standard Deviation 13.8986
95.00% Confidence Intervall ( 19479.82 - 19534.30 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5560
0.1 Scale Factor Error with Delta=300 4702
0.05 Scale Factor Error with Delta=300 18806
0.01 Scale Factor Error with Delta=300 470136
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 2851
Mean 95621.87
Minimum 89507.30
Maximum 104396.17
Spread ( max - min ) 14888.88
Range [ ( max - min ) / 2 * 100% ] 7.79%
Damage
Sample Data ripple in space Damage
Count 2851
Mean 28623049.57
Minimum 22707866.86
Maximum 34519929.74
Spread ( max - min ) 11812062.87
Range [ ( max - min ) / 2 * 100% ] 20.63%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.39 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.45 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.39 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.35 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.31 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.08 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.04 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.48 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.64 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.06 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKRQRMPQKQQQQQQQJKPPKPPOPQQQKQQQQKPOPPIPQKRQKRQRQKOPPPPPQQKQQQOQKQPPPPQKQQOQQKRQQGIKPPPPRKOQQRQKQQQRQKPPOPPPRKQQQQKQROQPKPPPPQQQHEFKIKORQRQKPRPKPRQRQKOPQRQQKQPPPPQOKPQQQQKRQQPKOPPGPIPQKQQKQQOPQQKPPPPQQKQRQOQKQPQPQKPPRQOQQKQQPQIKPPPOKQQQKRQQQPQKOPPPPPQLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.165 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.090 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, overwhelming_power(24), battle_potion_of_intellect
0:03.939 default P moonfire enemy5 27.5/100: 28% astral_power bloodlust, starlord, starfall, overwhelming_power(24), battle_potion_of_intellect
0:04.790 default P moonfire enemy7 31.0/100: 31% astral_power bloodlust, starlord, starfall, overwhelming_power(23), battle_potion_of_intellect
0:05.641 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, overwhelming_power(22), battle_potion_of_intellect
0:06.923 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, overwhelming_power(21), battle_potion_of_intellect
0:07.675 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, starfall, overwhelming_power(20), battle_potion_of_intellect
0:07.675 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, starfall, overwhelming_power(20), battle_potion_of_intellect
0:07.675 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, starfall, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse
0:08.431 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse
0:09.184 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse
0:09.938 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse
0:10.691 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse
0:11.443 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse
0:12.381 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, solar_empowerment, starlord(3), starfall, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.136 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.046 default O sunfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.801 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.556 default S sunfire Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.311 default L starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.064 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.818 default P moonfire Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.573 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.328 default P moonfire enemy2 76.5/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.083 default K starfall Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.839 default P moonfire enemy5 30.5/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.594 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.347 default P moonfire enemy6 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.102 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(24), ignition_mages_fuse(4)
0:23.856 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(24), ignition_mages_fuse(5)
0:24.611 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(23), ignition_mages_fuse(5)
0:25.367 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(22), ignition_mages_fuse(5)
0:26.132 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(2), starfall, overwhelming_power(21), ignition_mages_fuse(5)
0:26.886 default M sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(21), ignition_mages_fuse(5)
0:27.640 default P moonfire enemy3 38.0/100: 38% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), ignition_mages_fuse(5)
0:28.395 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(19)
0:29.652 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(18)
0:30.498 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(17)
0:31.730 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(16)
0:32.967 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(15)
0:34.207 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(13)
0:35.457 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(12)
0:36.712 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(11)
0:37.970 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(10)
0:39.235 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(8)
0:39.235 default K starfall Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, overwhelming_power(8)
0:40.161 default P moonfire Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar, starlord, starfall, overwhelming_power(7)
0:41.063 default P moonfire enemy2 49.0/100: 49% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(6)
0:42.238 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(5)
0:43.419 default P moonfire enemy4 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4)
0:44.568 default P moonfire enemy6 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(3)
0:45.723 default O sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(2)
0:46.882 default P moonfire enemy7 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power
0:48.046 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall
0:49.794 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall
0:51.546 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2)
0:53.296 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2)
0:54.463 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord(3), starfall
0:56.165 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord(3), starfall
0:57.868 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord(3), starfall
0:59.571 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starfall
1:01.428 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar
1:02.668 default P moonfire enemy4 12.5/100: 13% astral_power arcanic_pulsar, starlord, starfall
1:03.871 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:05.074 default P moonfire enemy5 20.0/100: 20% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:06.276 default P moonfire enemy6 24.0/100: 24% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:07.478 default I fury_of_elune Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
1:08.880 default P moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, conch_of_dark_whispers
1:10.083 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, fury_of_elune, starlord, conch_of_dark_whispers
1:11.883 default K starfall Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, conch_of_dark_whispers
1:13.087 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers
1:14.080 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), starfall, conch_of_dark_whispers
1:15.568 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers
1:16.738 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers
1:17.705 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
1:19.408 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, conch_of_dark_whispers
1:20.374 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
1:22.077 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starfall
1:23.315 default O sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord, starfall
1:24.516 default P moonfire enemy5 7.0/100: 7% astral_power arcanic_pulsar, starlord, starfall
1:25.719 default P moonfire enemy3 11.0/100: 11% astral_power arcanic_pulsar, starlord, starfall
1:26.922 default P moonfire enemy6 14.5/100: 14% astral_power arcanic_pulsar, starlord, starfall
1:28.124 default P moonfire enemy4 18.5/100: 19% astral_power arcanic_pulsar, starlord, starfall
1:29.327 default P moonfire enemy7 22.5/100: 23% astral_power arcanic_pulsar, starlord, starfall
1:30.530 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord
1:32.331 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord
1:34.134 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord
1:35.336 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall
1:37.087 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, starlord(2), starfall
1:38.838 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, starlord(2), starfall
1:40.587 default O sunfire Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall
1:41.756 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall
1:43.506 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar
1:44.745 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord, starfall
1:46.547 default P moonfire enemy5 24.0/100: 24% astral_power arcanic_pulsar, starlord, starfall
1:47.750 default P moonfire enemy2 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall
1:48.954 default P moonfire enemy6 31.5/100: 32% astral_power arcanic_pulsar, starlord, starfall
1:50.155 default P moonfire enemy7 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall
1:51.357 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall
1:53.159 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, torrent_of_elements
1:54.361 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
1:56.110 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(23)
1:57.722 default O sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(22)
1:58.803 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(21)
2:00.428 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(19)
2:02.062 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(17)
2:03.161 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(16)
2:04.073 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(15)
2:05.829 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(14)
2:07.591 default G use_items Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, overwhelming_power(12)
2:07.591 default I fury_of_elune Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, overwhelming_power(12), ignition_mages_fuse
2:08.812 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starfall, torrent_of_elements, overwhelming_power(11), ignition_mages_fuse
2:09.953 default P moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(10), ignition_mages_fuse
2:11.066 default P moonfire enemy2 15.0/100: 15% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse
2:12.127 default P moonfire enemy3 24.0/100: 24% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, overwhelming_power(23), ignition_mages_fuse(2)
2:13.151 default P moonfire enemy5 32.5/100: 33% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(2)
2:14.178 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(2)
2:15.053 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(2)
2:16.083 default O sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(3)
2:17.055 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(3)
2:18.516 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(3)
2:19.980 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(4)
2:20.781 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(4)
2:22.199 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(4)
2:23.153 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(4)
2:24.548 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(5)
2:25.897 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(5)
2:27.250 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(5)
2:28.023 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(7)
2:29.684 default K starfall Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(6)
2:30.896 default P moonfire enemy3 23.5/100: 24% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(5)
2:32.076 default P moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(3)
2:33.265 default O sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(2)
2:34.458 default P moonfire enemy2 34.5/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power
2:35.656 default P moonfire enemy5 38.5/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
2:36.860 default P moonfire enemy7 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
2:38.062 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord
2:39.082 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord
2:40.283 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord(2), starfall
2:42.034 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall
2:43.784 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall
2:45.535 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), starfall
2:47.285 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2)
2:48.454 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements
2:50.157 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements
2:51.212 default O sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starfall, torrent_of_elements
2:52.450 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starfall, torrent_of_elements
2:54.305 default P moonfire enemy7 48.0/100: 48% astral_power arcanic_pulsar, starfall, torrent_of_elements
2:55.543 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, torrent_of_elements
2:56.781 default P moonfire enemy2 2.5/100: 3% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
2:57.984 default P moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
2:59.186 default P moonfire enemy3 10.0/100: 10% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:00.388 default P moonfire enemy6 14.0/100: 14% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:01.593 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
3:03.396 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord, starfall
3:05.198 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord
3:07.002 default H celestial_alignment Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, starlord
3:08.048 default E potion Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar, celestial_alignment, starlord
3:08.048 default F berserking Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar, celestial_alignment, starlord, battle_potion_of_intellect
3:08.048 default K starfall Fluffy_Pillow 98.0/100: 98% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, battle_potion_of_intellect
3:09.000 default I fury_of_elune Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:09.925 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect
3:10.848 default O sunfire Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:11.748 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:12.649 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:13.995 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect
3:14.893 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, battle_potion_of_intellect
3:16.038 default K starfall Fluffy_Pillow 81.5/100: 82% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starfall, battle_potion_of_intellect
3:17.017 default P moonfire enemy4 37.0/100: 37% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, battle_potion_of_intellect
3:17.968 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, battle_potion_of_intellect
3:18.919 default P moonfire enemy5 49.5/100: 50% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, battle_potion_of_intellect
3:19.870 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, battle_potion_of_intellect
3:20.823 default P moonfire enemy2 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:21.841 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:22.856 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, battle_potion_of_intellect
3:24.151 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:25.168 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:26.690 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, battle_potion_of_intellect
3:27.708 default O sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:28.845 default P moonfire enemy3 5.0/100: 5% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:29.982 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:31.686 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, battle_potion_of_intellect
3:32.652 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord(3), starfall, battle_potion_of_intellect
3:34.355 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord(3), starfall
3:36.058 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar
3:37.299 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord, starfall
3:39.100 default P moonfire enemy4 21.0/100: 21% astral_power arcanic_pulsar, starlord, starfall
3:40.302 default P moonfire enemy5 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall
3:41.504 default P moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:42.706 default P moonfire enemy2 32.0/100: 32% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:43.907 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:45.708 default O sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord, conch_of_dark_whispers
3:46.909 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, conch_of_dark_whispers
3:48.111 default P moonfire enemy6 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:49.280 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:51.030 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:52.780 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:54.530 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:56.280 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, solar_empowerment
3:57.519 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
3:58.542 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall
4:00.073 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starlord, starfall
4:01.874 default P moonfire enemy5 46.0/100: 46% astral_power arcanic_pulsar, starlord, starfall
4:03.075 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, starfall
4:04.279 default O sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, starlord(2), starfall
4:05.448 default P moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall
4:06.617 default P moonfire enemy2 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall
4:07.788 default G use_items Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall
4:07.788 default P moonfire enemy4 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse
4:08.908 default I fury_of_elune Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, ignition_mages_fuse
4:10.119 default P moonfire enemy6 21.5/100: 22% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, ignition_mages_fuse
4:11.238 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord(2), torrent_of_elements, ignition_mages_fuse
4:12.913 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), torrent_of_elements, ignition_mages_fuse(2)
4:13.985 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, torrent_of_elements, ignition_mages_fuse(2)
4:15.551 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, torrent_of_elements, ignition_mages_fuse(2)
4:17.116 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starfall, torrent_of_elements, ignition_mages_fuse(3)
4:18.211 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse(3)
4:19.802 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse(4)
4:21.332 default O sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse(4)
4:22.355 default P moonfire enemy5 30.5/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse(4)
4:23.378 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, ignition_mages_fuse(4)
4:24.910 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(5)
4:26.281 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord, overwhelming_power(23), ignition_mages_fuse(5)
4:27.200 default P moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), ignition_mages_fuse(5)
4:28.097 default P moonfire enemy4 14.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21)
4:29.181 default P moonfire enemy6 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(20), conch_of_dark_whispers
4:30.268 default P moonfire enemy7 22.0/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19), conch_of_dark_whispers
4:31.360 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18), conch_of_dark_whispers
4:33.002 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), conch_of_dark_whispers
4:34.611 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(2), overwhelming_power(23), conch_of_dark_whispers
4:35.686 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22), conch_of_dark_whispers
4:37.260 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power(20), conch_of_dark_whispers
4:38.241 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, lunar_empowerment, starfall, overwhelming_power(19), conch_of_dark_whispers
4:39.713 default O sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starfall, overwhelming_power(18), conch_of_dark_whispers
4:40.875 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starfall, overwhelming_power(17), conch_of_dark_whispers
4:42.619 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, overwhelming_power(15), conch_of_dark_whispers
4:43.791 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14), conch_of_dark_whispers
4:45.501 default P moonfire enemy5 18.0/100: 18% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12)
4:46.653 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11)
4:48.384 default P moonfire enemy4 35.0/100: 35% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9)
4:49.546 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(8)
4:51.295 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(6)
4:52.472 default P moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(5)
4:53.619 default P moonfire enemy7 6.5/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(4)
4:54.771 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(3)
4:55.753 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(2)
4:57.490 default O sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall
4:58.658 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, starlord(2), starfall
5:00.407 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord(2)
5:02.157 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord(2)
5:03.325 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starfall
5:05.182 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starfall, overwhelming_power(24)
5:06.884 default P moonfire enemy5 39.5/100: 40% astral_power arcanic_pulsar, starfall, overwhelming_power(23)
5:08.024 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starfall, overwhelming_power(21)
5:09.745 default I fury_of_elune Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, starfall, overwhelming_power(20)
5:10.898 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, fury_of_elune, overwhelming_power(19)
5:12.055 default P moonfire enemy2 18.0/100: 18% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(17)
5:13.186 default P moonfire enemy4 26.5/100: 27% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(16)
5:14.319 default P moonfire enemy7 38.0/100: 38% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(24)
5:15.424 default O sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(23)
5:16.531 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(22)
5:17.643 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(21)
5:19.266 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19)
5:20.900 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(18)
5:22.539 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(16)
5:23.642 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(15)
5:24.557 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(14)
5:26.175 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(12)
5:27.805 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(11)
5:29.441 default P moonfire enemy5 51.5/100: 52% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(9)
5:30.541 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord(3), overwhelming_power(8)
5:32.194 default K starfall Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(6)
5:33.407 default O sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(5)
5:34.588 default P moonfire enemy2 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(4)
5:35.773 default P moonfire enemy3 26.5/100: 27% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(3)
5:36.961 default P moonfire enemy4 30.5/100: 31% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(2)
5:38.155 default P moonfire enemy6 34.0/100: 34% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
5:39.360 default P moonfire enemy7 38.0/100: 38% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
5:40.562 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord, torrent_of_elements
5:42.363 default L starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord, torrent_of_elements
5:43.565 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 98419 dps, 20033 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
98418.9 98418.9 87.3 / 0.089% 9256.6 / 9.4% 14525.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 98419
Fury of Elune 6063 6.2% 5.3 61.16sec 343287 335382 Direct 891.4 1663 3288 2033 22.8%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 891.43 136.86 0.00 1.0237 0.3047 1812403.81 1812403.81 0.00 38479.09 335381.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 688.60 77.25% 1663.44 1457 1987 1665.69 1587 1830 1145452 1145452 0.00
crit 202.83 22.75% 3288.19 2915 3974 3293.74 3039 3653 666952 666952 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 297 (1189) 0.3% (1.2%) 8.0 34.39sec 44759 0 Direct 8.0 9134 18253 11182 22.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 89063.88 89063.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.18 77.54% 9133.72 8921 9813 9126.83 0 9813 56412 56412 0.00
crit 1.79 22.46% 18252.91 17842 19626 15256.24 0 19626 32652 32652 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 892 0.9% 8.0 34.39sec 33577 0 Direct 55.8 3913 7831 4797 22.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 55.75 0.00 0.00 0.0000 0.0000 267435.16 267435.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.18 77.45% 3913.29 3823 4206 3913.86 3823 4206 168992 168992 0.00
crit 12.57 22.55% 7830.66 7646 8411 7818.50 0 8411 98443 98443 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11387 11.6% 82.9 3.55sec 41168 25897 Direct 580.6 4817 9587 5881 22.3%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.94 580.58 0.00 0.00 1.5897 0.0000 3414483.16 3414483.16 0.00 25896.53 25896.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 451.09 77.70% 4817.35 3345 24211 4821.26 4416 5330 2173112 2173112 0.00
crit 129.48 22.30% 9586.87 6689 48422 9594.95 7986 11843 1241371 1241371 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21721 22.1% 64.3 4.60sec 101150 93382 Direct 128.6 3478 6935 4248 22.3%  
Periodic 1494.9 3265 6508 3986 22.2% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.31 128.63 1494.89 1494.89 1.0832 1.3840 6505292.21 6505292.21 0.00 3041.91 93382.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.97 77.72% 3477.65 3280 4472 3479.32 3359 3663 347663 347663 0.00
crit 28.66 22.28% 6934.71 6559 8943 6938.21 6559 7551 198720 198720 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1162.5 77.76% 3265.01 3 4163 3266.58 3184 3388 3795459 3795459 0.00
crit 332.4 22.24% 6508.05 4 8327 6510.78 6262 6958 2163451 2163451 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1194 (4292) 1.2% (4.4%) 31.5 9.04sec 40847 46614 Direct 32.3 9077 18083 10999 21.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.45 32.34 0.00 0.00 0.8763 0.0000 355771.48 355771.48 0.00 46614.20 46614.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.44 78.65% 9076.77 7949 10838 9087.68 8510 9840 230899 230899 0.00
crit 6.91 21.35% 18082.63 15898 21676 18081.65 0 21676 124872 124872 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3097 3.2% 17.2 16.52sec 53902 0 Direct 120.7 7700 0 7700 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.24 120.65 0.00 0.00 0.0000 0.0000 929055.81 929055.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.65 100.00% 7700.14 5962 16257 7702.78 6058 10824 929056 929056 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starfall 30490 31.0% 39.5 7.61sec 231461 215101 Periodic 2465.1 3031 6052 3704 22.3% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.45 0.00 0.00 2465.10 1.0761 0.0000 9131466.81 9131466.81 0.00 215100.98 215100.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1916.0 77.73% 3031.49 2838 3869 3032.94 2957 3146 5808511 5808511 0.00
crit 549.1 22.27% 6052.17 5675 7738 6054.30 5857 6534 3322956 3322956 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 313 0.3% 1.4 275.53sec 66493 77231 Direct 1.2 62792 124311 75499 20.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.39 1.23 0.00 0.00 0.8616 0.0000 92754.65 92754.65 0.00 77231.18 77231.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.97 79.33% 62791.56 51347 69612 52976.43 0 69612 61182 61182 0.00
crit 0.25 20.67% 124311.30 102695 139223 30037.93 0 139223 31572 31572 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 3003 3.0% 45.0 4.60sec 19746 0 Direct 45.0 16370 32760 19745 20.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 45.00 0.00 0.00 0.0000 0.0000 888494.45 888494.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.73 79.40% 16370.29 16021 17623 16370.22 16021 17623 584897 584897 0.00
crit 9.27 20.60% 32760.31 32042 35246 32748.33 0 35246 303598 303598 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19960 20.3% 18.5 16.36sec 322871 307624 Direct 18.5 4445 8861 5416 22.0%  
Periodic 1507.6 3191 6358 3898 22.3% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.51 18.51 1507.59 1507.59 1.0496 1.3831 5977140.12 5977140.12 0.00 2840.06 307624.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.44 78.00% 4445.13 4112 5607 4447.58 4204 4793 64187 64187 0.00
crit 4.07 22.00% 8861.39 8225 11214 8777.05 0 11214 36089 36089 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1170.9 77.67% 3190.74 10 4065 3192.29 3112 3317 3735998 3735998 0.00
crit 336.7 22.33% 6358.25 55 8130 6360.73 6153 6808 2140866 2140866 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.13sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.91sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9087 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 267.4sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.42%
  • arcanic_pulsar_2:0.73%
  • arcanic_pulsar_3:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.1sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.1sec 184.1sec 8.11% 8.30% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.9sec 183.9sec 13.52% 19.10% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.4sec 45.8sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.2sec 61.2sec 13.91% 0.00% 83.4(83.4) 5.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.01% 0.00% 2.7(2.7) 2.7

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.91%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 47.1sec 36.6sec 9.32% 8.96% 0.1(0.1) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.88%
  • lunar_empowerment_2:1.84%
  • lunar_empowerment_3:0.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.3 65.2sec 34.9sec 46.57% 0.00% 3.3(45.2) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.35%
  • overwhelming_power_2:1.39%
  • overwhelming_power_3:1.43%
  • overwhelming_power_4:1.47%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.63%
  • overwhelming_power_9:1.67%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.77%
  • overwhelming_power_12:1.82%
  • overwhelming_power_13:1.87%
  • overwhelming_power_14:1.92%
  • overwhelming_power_15:1.98%
  • overwhelming_power_16:2.04%
  • overwhelming_power_17:2.10%
  • overwhelming_power_18:2.16%
  • overwhelming_power_19:2.22%
  • overwhelming_power_20:2.28%
  • overwhelming_power_21:2.35%
  • overwhelming_power_22:2.42%
  • overwhelming_power_23:2.49%
  • overwhelming_power_24:2.56%
  • overwhelming_power_25:1.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 3.9 0.0 68.0sec 68.0sec 5.18% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.8 83.0 68.0sec 3.4sec 91.22% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.51%
  • reckless_force_counter_2:5.23%
  • reckless_force_counter_3:5.26%
  • reckless_force_counter_4:5.11%
  • reckless_force_counter_5:5.01%
  • reckless_force_counter_6:5.05%
  • reckless_force_counter_7:4.88%
  • reckless_force_counter_8:4.90%
  • reckless_force_counter_9:4.84%
  • reckless_force_counter_10:4.74%
  • reckless_force_counter_11:4.70%
  • reckless_force_counter_12:4.71%
  • reckless_force_counter_13:4.64%
  • reckless_force_counter_14:4.65%
  • reckless_force_counter_15:4.56%
  • reckless_force_counter_16:4.42%
  • reckless_force_counter_17:4.41%
  • reckless_force_counter_18:4.33%
  • reckless_force_counter_19:4.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 17.7 0.1 16.5sec 16.4sec 12.60% 52.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.56%
  • solar_empowerment_2:0.05%
  • solar_empowerment_3:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.8 18.6 14.6sec 7.6sec 88.01% 0.00% 18.6(18.6) 20.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.7 27.1 22.6sec 7.4sec 88.23% 85.52% 1.2(1.2) 11.5

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.92%
  • starlord_2:31.00%
  • starlord_3:24.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.6sec 23.59% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.59%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starfall Astral Power 39.5 1972.6 50.0 50.0 4629.2
starsurge Astral Power 1.4 55.8 40.0 40.0 1662.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.45 259.58 (13.03%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.37 208.42 (10.46%) 2.50 0.00 0.00%
sunfire Astral Power 18.51 55.54 (2.79%) 3.00 0.00 0.00%
moonfire Astral Power 64.32 192.95 (9.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.94 995.26 (49.96%) 12.00 0.01 0.00%
natures_balance Astral Power 400.35 200.17 (10.05%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.76
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.21 0.00 61.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data unbound force Damage Per Second
Count 2851
Mean 98418.90
Minimum 91262.05
Maximum 106909.40
Spread ( max - min ) 15647.35
Range [ ( max - min ) / 2 * 100% ] 7.95%
Standard Deviation 2379.2482
5th Percentile 94679.11
95th Percentile 102564.01
( 95th Percentile - 5th Percentile ) 7884.90
Mean Distribution
Standard Deviation 44.5596
95.00% Confidence Intervall ( 98331.56 - 98506.23 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2246
0.1 Scale Factor Error with Delta=300 48325
0.05 Scale Factor Error with Delta=300 193297
0.01 Scale Factor Error with Delta=300 4832404
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 2851
Mean 20032.99
Minimum 17966.70
Maximum 22615.27
Spread ( max - min ) 4648.57
Range [ ( max - min ) / 2 * 100% ] 11.60%
Standard Deviation 765.5667
5th Percentile 18861.58
95th Percentile 21361.15
( 95th Percentile - 5th Percentile ) 2499.57
Mean Distribution
Standard Deviation 14.3379
95.00% Confidence Intervall ( 20004.89 - 20061.09 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5611
0.1 Scale Factor Error with Delta=300 5004
0.05 Scale Factor Error with Delta=300 20013
0.01 Scale Factor Error with Delta=300 500323
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 2851
Mean 98418.90
Minimum 91262.05
Maximum 106909.40
Spread ( max - min ) 15647.35
Range [ ( max - min ) / 2 * 100% ] 7.95%
Damage
Sample Data unbound force Damage
Count 2851
Mean 29463361.54
Minimum 23138315.83
Maximum 36044958.74
Spread ( max - min ) 12906642.91
Range [ ( max - min ) / 2 * 100% ] 21.90%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.28 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.45 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.39 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.37 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.30 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.07 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.02 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.57 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.50 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.07 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRNQQQKQQOQQQRQKPKPPQQPPQKOQQRQKPQRPIPKOPPQKQQQKQPROPQRKPPQQQKRQOPPPRKQQPPPQKQOQGIRKPQQKQPPPORKQRQQKQPPQQQKOPPPPQQKQQRQKOQQPPPPHEFKIPKRQRKRORQKRQRQRQNPKPPPROQKQQRQKQPPQQKOPPPRQRKQQRGPIOKPPPQKPQRQKQRQOQKPPQPPQQKPQORQKQPQQQKPPPOPQQIKQQKQQKPOPPPRPQQKQQRQKQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.163 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, reckless_force_counter, battle_potion_of_intellect
0:03.090 default P moonfire enemy3 24.0/100: 24% astral_power bloodlust, starlord, starfall, reckless_force_counter(2), battle_potion_of_intellect
0:04.016 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, reckless_force_counter(2), battle_potion_of_intellect
0:04.941 default P moonfire enemy7 31.0/100: 31% astral_power bloodlust, starlord, starfall, reckless_force_counter(4), battle_potion_of_intellect
0:05.866 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, reckless_force_counter(4), battle_potion_of_intellect
0:07.254 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, reckless_force_counter(4), battle_potion_of_intellect
0:08.059 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, reckless_force_counter(5), battle_potion_of_intellect
0:08.059 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, reckless_force_counter(5), battle_potion_of_intellect
0:08.059 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse
0:08.812 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:09.566 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse
0:10.321 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:11.075 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:11.828 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:12.822 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.575 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.527 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.282 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.037 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.794 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.548 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.300 default P moonfire enemy2 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.056 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.810 default P moonfire enemy3 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.565 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, reckless_force_counter(11), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.318 default P moonfire enemy4 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, reckless_force_counter(11), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.072 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, reckless_force_counter(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.828 default P moonfire enemy6 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, reckless_force_counter(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.582 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, reckless_force_counter(13), ignition_mages_fuse(4)
0:24.337 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, starfall, reckless_force_counter(13), ignition_mages_fuse(5)
0:25.090 default P moonfire enemy7 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, reckless_force_counter(13), ignition_mages_fuse(5)
0:25.844 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), starfall, reckless_force_counter(13), ignition_mages_fuse(5)
0:26.600 default N moonfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, reckless_force_counter(13), ignition_mages_fuse(5)
0:27.355 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(3), starlord(2), starfall, reckless_force_counter(13), ignition_mages_fuse(5)
0:28.294 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(2), starfall, reckless_force_counter(13)
0:29.439 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, reckless_force_counter(13)
0:30.584 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, reckless_force_counter(13)
0:31.484 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, reckless_force_counter(13)
0:32.794 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, reckless_force_counter(13)
0:34.103 default O sunfire Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, reckless_force_counter(13)
0:34.978 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, reckless_force_counter(13)
0:36.290 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(24), reckless_force_counter(13)
0:37.492 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(23), reckless_force_counter(13)
0:38.699 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(14)
0:39.453 default Q lunar_strike Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(21), reckless_force_counter(14)
0:40.668 default K starfall Fluffy_Pillow 99.0/100: 99% astral_power bloodlust, arcanic_pulsar, overwhelming_power(20), reckless_force_counter(15)
0:41.555 default P moonfire enemy3 49.5/100: 50% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), reckless_force_counter(15)
0:42.678 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18), reckless_force_counter(15)
0:43.804 default P moonfire enemy7 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(17), reckless_force_counter(15)
0:44.902 default P moonfire enemy5 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), reckless_force_counter(15)
0:46.005 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(14), reckless_force_counter(15)
0:47.669 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), reckless_force_counter(16)
0:49.339 default P moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), reckless_force_counter(16)
0:50.461 default P moonfire enemy4 41.5/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(10), reckless_force_counter(16)
0:51.589 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), overwhelming_power(9), reckless_force_counter(17)
0:53.283 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2), overwhelming_power(7), reckless_force_counter(17)
0:54.422 default O sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(6), reckless_force_counter(17)
0:55.534 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(5), reckless_force_counter(17)
0:57.205 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(3), reckless_force_counter(18)
0:58.889 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(2), reckless_force_counter(18)
0:59.847 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power, reckless_force_counter(18)
1:01.545 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, reckless_force_counter(18)
1:02.784 default P moonfire enemy6 11.5/100: 12% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(19)
1:03.985 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reckless_force, arcanic_pulsar, starlord, starfall
1:05.785 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power reckless_force, arcanic_pulsar, solar_empowerment, starlord, starfall
1:06.809 default P moonfire enemy3 37.5/100: 38% astral_power reckless_force, arcanic_pulsar, starlord, starfall
1:08.013 default I fury_of_elune Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements
1:09.261 default P moonfire enemy5 47.0/100: 47% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, torrent_of_elements
1:10.463 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, torrent_of_elements, reckless_force_counter
1:11.666 default O sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, reckless_force_counter
1:12.835 default P moonfire enemy4 23.0/100: 23% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, reckless_force_counter
1:14.005 default P moonfire enemy7 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, reckless_force_counter
1:15.174 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, reckless_force_counter
1:16.924 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(2)
1:18.093 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(2)
1:19.798 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(2)
1:21.501 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(3)
1:23.204 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starfall, reckless_force_counter(4), conch_of_dark_whispers
1:24.443 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(4), conch_of_dark_whispers
1:26.244 default P moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(5), conch_of_dark_whispers
1:27.448 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(5), conch_of_dark_whispers
1:28.472 default O sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(6), conch_of_dark_whispers
1:29.674 default P moonfire enemy3 31.5/100: 32% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(6), conch_of_dark_whispers
1:30.876 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(6), conch_of_dark_whispers
1:32.679 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord, reckless_force_counter(6), conch_of_dark_whispers
1:33.700 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord, reckless_force_counter(6), conch_of_dark_whispers
1:34.902 default P moonfire enemy6 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(6), conch_of_dark_whispers
1:36.071 default P moonfire enemy7 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(7), conch_of_dark_whispers
1:37.239 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(8)
1:38.989 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(8)
1:40.741 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(8)
1:42.492 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord(2), reckless_force_counter(8)
1:43.660 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, solar_empowerment, starfall, reckless_force_counter(9)
1:44.713 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, starfall, reckless_force_counter(9)
1:46.570 default O sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starfall, reckless_force_counter(9)
1:47.810 default P moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starfall, reckless_force_counter(9)
1:49.049 default P moonfire enemy5 35.5/100: 36% astral_power arcanic_pulsar, solar_empowerment, starfall, reckless_force_counter(9)
1:50.289 default P moonfire enemy3 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starfall, reckless_force_counter(10)
1:51.528 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, solar_empowerment, reckless_force_counter(10)
1:52.579 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, reckless_force_counter(10)
1:53.819 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(10)
1:55.621 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(10)
1:57.421 default P moonfire enemy2 29.0/100: 29% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(11)
1:58.624 default P moonfire enemy4 33.0/100: 33% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(11)
1:59.827 default P moonfire enemy7 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(11)
2:01.029 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, reckless_force_counter(11)
2:02.829 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord, reckless_force_counter(13)
2:04.032 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(14)
2:05.782 default O sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(14)
2:06.952 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(14)
2:08.701 default G use_items Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, reckless_force_counter(15)
2:08.701 default I fury_of_elune Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, reckless_force_counter(15), ignition_mages_fuse
2:09.821 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall, reckless_force_counter(15), ignition_mages_fuse
2:10.772 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, reckless_force_counter(15), ignition_mages_fuse
2:11.891 default P moonfire enemy3 9.5/100: 10% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, reckless_force_counter(15), ignition_mages_fuse
2:12.980 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, fury_of_elune, starfall, reckless_force_counter(15), ignition_mages_fuse(2)
2:14.687 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, fury_of_elune, starfall, reckless_force_counter(15), ignition_mages_fuse(2)
2:16.391 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, fury_of_elune, starfall, reckless_force_counter(16), ignition_mages_fuse(2)
2:17.528 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(16), ignition_mages_fuse(3)
2:19.118 default P moonfire enemy2 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(16), ignition_mages_fuse(3)
2:20.179 default P moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(16), ignition_mages_fuse(3)
2:21.241 default P moonfire enemy7 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(17), ignition_mages_fuse(4)
2:22.264 default O sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(18), ignition_mages_fuse(4)
2:23.287 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, reckless_force_counter(18), ignition_mages_fuse(4)
2:24.155 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(19), ignition_mages_fuse(4)
2:25.178 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(19), ignition_mages_fuse(5)
2:26.614 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, reckless_force_counter(19), ignition_mages_fuse(5)
2:27.428 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(19), ignition_mages_fuse(5)
2:28.862 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(19)
2:30.612 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(24), reckless_force_counter(19)
2:31.685 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power reckless_force, arcanic_pulsar, starlord(3), starfall, overwhelming_power(23)
2:33.254 default P moonfire enemy5 14.0/100: 14% astral_power reckless_force, arcanic_pulsar, starlord(3), starfall, overwhelming_power(21)
2:34.306 default P moonfire enemy3 17.5/100: 18% astral_power reckless_force, arcanic_pulsar, starlord(3), starfall, overwhelming_power(20)
2:35.364 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(19)
2:36.955 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starfall, overwhelming_power(18), reckless_force_counter
2:38.693 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, overwhelming_power(24), reckless_force_counter
2:40.395 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, overwhelming_power(22), reckless_force_counter
2:41.538 default O sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21), reckless_force_counter
2:42.653 default P moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(20), reckless_force_counter(2)
2:43.771 default P moonfire enemy4 19.0/100: 19% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), reckless_force_counter(2)
2:44.893 default P moonfire enemy6 22.5/100: 23% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), reckless_force_counter(2)
2:45.996 default P moonfire enemy7 26.5/100: 27% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(23), reckless_force_counter(2)
2:47.104 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(21), reckless_force_counter(2)
2:48.774 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord, overwhelming_power(20), reckless_force_counter(2)
2:50.449 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord, overwhelming_power(18), reckless_force_counter(2)
2:51.575 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), reckless_force_counter(2)
2:53.175 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), reckless_force_counter(4)
2:54.789 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(22), reckless_force_counter(6)
2:55.706 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21), reckless_force_counter(6)
2:57.329 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19), reckless_force_counter(7)
2:58.419 default O sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(18), reckless_force_counter(7)
2:59.483 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24), reckless_force_counter(7)
3:01.046 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starfall, overwhelming_power(22), reckless_force_counter(8)
3:02.759 default P moonfire enemy7 35.5/100: 36% astral_power arcanic_pulsar, starfall, overwhelming_power(21), reckless_force_counter(8)
3:03.907 default P moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starfall, overwhelming_power(20), reckless_force_counter(8)
3:05.060 default P moonfire enemy3 43.0/100: 43% astral_power arcanic_pulsar, starfall, overwhelming_power(18), reckless_force_counter(8)
3:06.221 default P moonfire enemy5 47.0/100: 47% astral_power arcanic_pulsar, overwhelming_power(17), reckless_force_counter(8)
3:07.386 default H celestial_alignment Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, overwhelming_power(16), reckless_force_counter(9)
3:08.401 default E potion Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, overwhelming_power(15), reckless_force_counter(11)
3:08.401 default F berserking Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, overwhelming_power(15), reckless_force_counter(11), battle_potion_of_intellect
3:08.401 default K starfall Fluffy_Pillow 91.5/100: 92% astral_power berserking, arcanic_pulsar, celestial_alignment, overwhelming_power(15), reckless_force_counter(11), battle_potion_of_intellect
3:09.328 default I fury_of_elune Fluffy_Pillow 42.0/100: 42% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, overwhelming_power(14), reckless_force_counter(11), battle_potion_of_intellect
3:10.232 default P moonfire enemy6 45.0/100: 45% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(13), reckless_force_counter(11), battle_potion_of_intellect
3:11.141 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(12), reckless_force_counter(11), battle_potion_of_intellect
3:12.052 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(11), reckless_force_counter(11), battle_potion_of_intellect
3:12.942 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(25), reckless_force_counter(11), battle_potion_of_intellect
3:14.208 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(23), reckless_force_counter(11), battle_potion_of_intellect
3:15.059 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, overwhelming_power(24), reckless_force_counter(11), battle_potion_of_intellect
3:15.907 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(24), reckless_force_counter(12), battle_potion_of_intellect
3:16.732 default O sunfire Fluffy_Pillow 21.0/100: 21% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(23), reckless_force_counter(12), battle_potion_of_intellect
3:17.560 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(22), reckless_force_counter(12), battle_potion_of_intellect
3:18.392 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(21), reckless_force_counter(13), battle_potion_of_intellect
3:19.455 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(20), reckless_force_counter(13), battle_potion_of_intellect
3:20.291 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(24), reckless_force_counter(13), battle_potion_of_intellect
3:21.116 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(23), reckless_force_counter(13), battle_potion_of_intellect
3:22.277 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(22), reckless_force_counter(13), battle_potion_of_intellect
3:23.191 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(21), reckless_force_counter(13), battle_potion_of_intellect
3:24.565 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(20), reckless_force_counter(14), battle_potion_of_intellect
3:25.486 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(19), reckless_force_counter(14), battle_potion_of_intellect
3:26.869 default N moonfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), starfall, overwhelming_power(18), reckless_force_counter(15), battle_potion_of_intellect
3:27.796 default P moonfire enemy7 69.5/100: 70% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(15), battle_potion_of_intellect
3:28.865 default K starfall Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(16), reckless_force_counter(15), battle_potion_of_intellect
3:30.035 default P moonfire enemy3 24.0/100: 24% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(14), reckless_force_counter(15), battle_potion_of_intellect
3:31.177 default P moonfire enemy6 27.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(13), reckless_force_counter(15), battle_potion_of_intellect
3:32.324 default P moonfire enemy4 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(12), reckless_force_counter(16), battle_potion_of_intellect
3:33.476 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(11), reckless_force_counter(17)
3:34.458 default O sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(10), reckless_force_counter(18)
3:35.617 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9), reckless_force_counter(18)
3:37.360 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord, overwhelming_power(7), reckless_force_counter(18)
3:38.531 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(6), reckless_force_counter(18)
3:40.244 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4), reckless_force_counter(19)
3:41.968 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(3), reckless_force_counter(19)
3:42.950 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(2), reckless_force_counter(19)
3:44.688 default K starfall Fluffy_Pillow 59.5/100: 60% astral_power reckless_force, arcanic_pulsar, starlord(2), starfall
3:45.857 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power reckless_force, arcanic_pulsar, starlord(3), starfall, conch_of_dark_whispers
3:47.559 default P moonfire enemy2 23.5/100: 24% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:48.697 default P moonfire enemy3 27.0/100: 27% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter, conch_of_dark_whispers
3:49.833 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starfall, torrent_of_elements, reckless_force_counter, conch_of_dark_whispers
3:51.689 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starfall, torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:53.543 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:54.782 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:55.983 default P moonfire enemy4 12.0/100: 12% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
3:57.185 default P moonfire enemy5 16.0/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
3:58.388 default P moonfire enemy6 19.5/100: 20% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
3:59.591 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
4:00.614 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(4)
4:02.415 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(5)
4:03.438 default K starfall Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, lunar_empowerment, starlord, torrent_of_elements, reckless_force_counter(5)
4:04.642 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(6)
4:06.130 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(7)
4:07.881 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(8)
4:08.875 default G use_items Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(8)
4:08.875 default P moonfire enemy2 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(8), ignition_mages_fuse
4:09.995 default I fury_of_elune Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(8), ignition_mages_fuse
4:11.113 default O sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(8), ignition_mages_fuse
4:12.233 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse
4:13.354 default P moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(3), starfall, torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse(2)
4:14.399 default P moonfire enemy5 22.5/100: 23% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starfall, torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse(2)
4:15.538 default P moonfire enemy6 33.5/100: 34% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starfall, torrent_of_elements, reckless_force_counter(9), ignition_mages_fuse(2)
4:16.677 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starfall, torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse(2)
4:18.127 default K starfall Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, starfall, torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse(3)
4:19.221 default P moonfire enemy7 13.5/100: 14% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(11), ignition_mages_fuse(3)
4:20.282 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(3)
4:21.873 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(4)
4:22.744 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(4)
4:24.274 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(4)
4:25.296 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(5)
4:26.730 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(5)
4:27.545 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(5)
4:28.764 default O sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(12), ignition_mages_fuse(5)
4:29.721 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(12)
4:31.470 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(12)
4:32.640 default P moonfire enemy2 4.5/100: 5% astral_power arcanic_pulsar, starlord(3), starfall, reckless_force_counter(12)
4:33.776 default P moonfire enemy4 8.5/100: 9% astral_power arcanic_pulsar, starlord(3), starfall, reckless_force_counter(12)
4:34.914 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(12)
4:36.615 default P moonfire enemy5 25.0/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(13)
4:37.754 default P moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, reckless_force_counter(13)
4:38.890 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starfall, torrent_of_elements, reckless_force_counter(13)
4:40.746 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, torrent_of_elements, reckless_force_counter(13)
4:42.602 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, torrent_of_elements, reckless_force_counter(13)
4:43.842 default P moonfire enemy6 10.0/100: 10% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(13)
4:45.045 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(13)
4:46.848 default O sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(15)
4:48.052 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(15)
4:49.073 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(16)
4:50.875 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord, reckless_force_counter(16)
4:52.078 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(16)
4:53.827 default P moonfire enemy2 16.5/100: 17% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(17), conch_of_dark_whispers
4:54.995 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(17), conch_of_dark_whispers
4:56.747 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(17), conch_of_dark_whispers
4:58.497 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(2), starfall, reckless_force_counter(17), conch_of_dark_whispers
5:00.248 default K starfall Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(2), reckless_force_counter(17), conch_of_dark_whispers
5:01.416 default P moonfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, starlord(3), starfall, reckless_force_counter(18), conch_of_dark_whispers
5:02.552 default P moonfire enemy3 14.5/100: 14% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(24), reckless_force_counter(18), conch_of_dark_whispers
5:03.594 default P moonfire enemy6 18.0/100: 18% astral_power arcanic_pulsar, starfall, overwhelming_power(23), reckless_force_counter(18), conch_of_dark_whispers
5:04.733 default O sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starfall, overwhelming_power(22), reckless_force_counter(18), conch_of_dark_whispers
5:05.879 default P moonfire enemy7 25.5/100: 26% astral_power reckless_force, arcanic_pulsar, starfall, overwhelming_power(21), conch_of_dark_whispers
5:07.029 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power reckless_force, arcanic_pulsar, starfall, overwhelming_power(19), conch_of_dark_whispers
5:08.761 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power reckless_force, arcanic_pulsar, overwhelming_power(18)
5:10.500 default I fury_of_elune Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, overwhelming_power(16)
5:11.669 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, fury_of_elune, overwhelming_power(15), reckless_force_counter
5:12.840 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(14), reckless_force_counter(2)
5:14.551 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(12), reckless_force_counter(2)
5:16.277 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, overwhelming_power(10), reckless_force_counter(3)
5:17.437 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(9), reckless_force_counter(4)
5:19.132 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(7), reckless_force_counter(5)
5:20.839 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(6), reckless_force_counter(5)
5:21.983 default P moonfire enemy7 1.5/100: 2% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(5), reckless_force_counter(6)
5:23.100 default O sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(3), reckless_force_counter(6)
5:24.223 default P moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power(2), reckless_force_counter(6)
5:25.351 default P moonfire enemy5 12.5/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, overwhelming_power, reckless_force_counter(6)
5:26.482 default P moonfire enemy4 16.5/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, reckless_force_counter(6)
5:27.618 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, reckless_force_counter(6)
5:28.584 default P moonfire enemy3 29.0/100: 29% astral_power arcanic_pulsar, starlord(3), starfall, reckless_force_counter(7)
5:29.720 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(3), reckless_force_counter(7)
5:31.424 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), reckless_force_counter(9)
5:33.126 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, reckless_force_counter(10)
5:34.366 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord, starfall, reckless_force_counter(10)
5:36.167 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(10)
5:37.969 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, reckless_force_counter(10)
5:38.992 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(10)
5:40.794 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, reckless_force_counter(11)
5:41.995 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(11)
5:43.746 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, reckless_force_counter(12)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 96444 dps, 20174 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
96443.7 96443.7 78.9 / 0.082% 8424.3 / 8.7% 14340.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.7 6.6 Astral Power 0.00% 50.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 96444
Fury of Elune 5276 5.5% 4.4 71.98sec 354920 354336 Direct 775.0 1720 3437 2038 18.5%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.45 774.97 119.14 0.00 1.0018 0.2968 1579275.76 1579275.76 0.00 39667.34 354336.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 631.39 81.47% 1719.76 1472 2007 1719.54 1663 1855 1085858 1085858 0.00
crit 143.58 18.53% 3436.55 2944 4015 3435.34 3223 3729 493418 493418 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 284 (1136) 0.3% (1.2%) 7.8 35.27sec 43847 0 Direct 7.8 9229 18469 10950 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 7.77 0.00 0.00 0.0000 0.0000 85122.45 85122.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 81.39% 9228.92 9012 9913 9231.72 9012 9913 58394 58394 0.00
crit 1.45 18.61% 18469.41 18024 19826 14331.51 0 19826 26729 26729 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 852 0.9% 7.8 35.27sec 32898 0 Direct 54.4 3956 7911 4700 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.77 54.42 0.00 0.00 0.0000 0.0000 255764.27 255764.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.18 81.19% 3955.80 3862 4248 3956.65 3862 4248 174784 174784 0.00
crit 10.24 18.81% 7910.70 7725 8497 7899.45 0 8497 80980 80980 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11133 11.5% 81.6 3.60sec 40893 25555 Direct 571.4 4924 9831 5842 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.62 571.36 0.00 0.00 1.6002 0.0000 3337790.06 3337790.06 0.00 25554.61 25554.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 464.54 81.30% 4924.32 3379 24458 4924.89 4524 5469 2287523 2287523 0.00
crit 106.83 18.70% 9831.25 6757 48917 9834.38 8083 12505 1050267 1050267 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 21365 22.2% 64.1 4.61sec 99932 91751 Direct 128.2 3525 7047 4183 18.7%  
Periodic 1492.2 3314 6627 3934 18.7% 689.7%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.11 128.22 1492.23 1492.23 1.0892 1.3860 6406604.43 6406604.43 0.00 2996.45 91750.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.24 81.30% 3524.52 3313 4517 3525.18 3404 3717 367407 367407 0.00
crit 23.98 18.70% 7047.03 6626 9035 7048.01 6653 7657 168983 168983 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1213.1 81.29% 3314.21 2 4206 3314.50 3231 3447 4020536 4020536 0.00
crit 279.1 18.71% 6626.58 6 8412 6626.43 6390 6898 1849679 1849679 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1257 (4346) 1.3% (4.5%) 33.9 8.46sec 38465 44381 Direct 34.7 9198 18408 10876 18.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.88 34.69 0.00 0.00 0.8667 0.0000 377280.98 377280.98 0.00 44380.61 44380.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.37 81.78% 9197.75 8030 10949 9206.93 8710 10025 260960 260960 0.00
crit 6.32 18.22% 18407.81 16060 21898 18387.43 0 21898 116321 116321 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3090 3.2% 17.4 16.34sec 53149 0 Direct 121.9 7593 0 7593 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.42 121.92 0.00 0.00 0.0000 0.0000 925733.66 925733.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.92 100.00% 7592.58 6023 16423 7594.38 6134 10158 925734 925734 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12045.17
  • base_dd_max:12045.17
  • base_dd_mult:1.00
 
Starfall 29694 30.8% 39.0 7.69sec 228079 211268 Periodic 2438.8 3077 6155 3652 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.05 0.00 0.00 2438.82 1.0796 0.0000 8906195.74 8906195.74 0.00 211267.57 211267.57
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1983.6 81.34% 3077.41 2867 3908 3077.28 2997 3205 6104546 6104546 0.00
crit 455.2 18.66% 6154.79 5733 7817 6154.00 5957 6416 2801649 2801649 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 361 0.4% 1.6 218.20sec 66648 79686 Direct 1.4 63569 127783 75558 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.61 1.42 0.00 0.00 0.8366 0.0000 107417.33 107417.33 0.00 79686.44 79686.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.16 81.32% 63569.00 51872 70323 55689.56 0 70323 73488 73488 0.00
crit 0.27 18.68% 127783.36 103744 140646 32398.89 0 140646 33929 33929 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 3498 3.6% 53.8 4.39sec 19603 0 Direct 53.8 16554 33105 19602 18.4%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.77 53.77 0.00 0.00 0.0000 0.0000 1054129.03 1054129.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.87 81.57% 16553.59 16184 17803 16552.30 16184 17803 726133 726133 0.00
crit 9.91 18.43% 33104.67 32369 35606 33089.77 0 35606 327996 327996 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 19635 20.4% 18.5 16.40sec 318556 303579 Direct 18.5 4502 9003 5329 18.4%  
Periodic 1505.2 3240 6476 3846 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.48 18.48 1505.25 1505.25 1.0494 1.3853 5887306.35 5887306.35 0.00 2797.26 303578.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.09 81.63% 4502.01 4154 5664 4502.67 4201 4815 67918 67918 0.00
crit 3.40 18.37% 9003.15 8309 11329 8786.07 0 11329 30571 30571 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1223.4 81.27% 3239.53 57 4107 3239.83 3159 3369 3963188 3963188 0.00
crit 281.9 18.73% 6476.38 114 8213 6476.26 6285 6750 1825629 1825629 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 1.5 296.72sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 148.12sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.46 0.00 0.00 0.00 0.9263 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:144.965
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.4 0.0sec 213.8sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:87.28%
  • arcanic_pulsar_2:6.84%
  • arcanic_pulsar_3:0.07%
  • arcanic_pulsar_4:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 156.2sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 1.5 0.0 296.5sec 296.5sec 5.51% 6.42% 0.0(0.0) 1.4

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:5.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.5 0.0 148.1sec 148.1sec 15.80% 22.95% 0.0(0.0) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:15.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.59% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 4.4 0.0 72.0sec 72.0sec 11.82% 0.00% 70.7(70.7) 4.4

Buff details

  • buff initial source:visions
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:11.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.5 0.0 148.3sec 148.3sec 15.75% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.23%
  • ignition_mages_fuse_2:3.19%
  • ignition_mages_fuse_3:3.15%
  • ignition_mages_fuse_4:3.11%
  • ignition_mages_fuse_5:3.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.9 1.7 43.4sec 34.2sec 9.58% 9.83% 0.1(0.1) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:7.26%
  • lunar_empowerment_2:1.77%
  • lunar_empowerment_3:0.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.2 65.9sec 35.3sec 46.32% 0.00% 3.2(45.2) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.34%
  • overwhelming_power_2:1.38%
  • overwhelming_power_3:1.42%
  • overwhelming_power_4:1.46%
  • overwhelming_power_5:1.49%
  • overwhelming_power_6:1.53%
  • overwhelming_power_7:1.57%
  • overwhelming_power_8:1.62%
  • overwhelming_power_9:1.66%
  • overwhelming_power_10:1.71%
  • overwhelming_power_11:1.76%
  • overwhelming_power_12:1.81%
  • overwhelming_power_13:1.86%
  • overwhelming_power_14:1.91%
  • overwhelming_power_15:1.97%
  • overwhelming_power_16:2.03%
  • overwhelming_power_17:2.09%
  • overwhelming_power_18:2.15%
  • overwhelming_power_19:2.21%
  • overwhelming_power_20:2.27%
  • overwhelming_power_21:2.34%
  • overwhelming_power_22:2.41%
  • overwhelming_power_23:2.49%
  • overwhelming_power_24:2.56%
  • overwhelming_power_25:1.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.9 0.2 16.4sec 16.2sec 12.90% 50.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.81%
  • solar_empowerment_2:0.09%
  • solar_empowerment_3:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 21.7 17.4 14.0sec 7.7sec 86.67% 0.00% 17.4(17.4) 21.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:86.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.5 27.1 23.0sec 7.4sec 86.97% 84.92% 1.5(1.5) 11.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.00%
  • starlord_2:31.99%
  • starlord_3:22.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.77% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.77%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starfall Astral Power 39.0 1952.4 50.0 50.0 4561.8
starsurge Astral Power 1.6 64.5 40.0 40.0 1666.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 34.87 278.95 (14.08%) 8.00 0.05 0.02%
celestial_alignment Astral Power 2.46 98.30 (4.96%) 40.00 0.00 0.00%
fury_of_elune Astral Power 70.69 176.71 (8.92%) 2.50 0.00 0.00%
sunfire Astral Power 18.48 55.44 (2.80%) 3.00 0.00 0.00%
moonfire Astral Power 64.11 192.34 (9.71%) 3.00 0.00 0.00%
lunar_strike Astral Power 81.62 979.46 (49.43%) 12.00 0.00 0.00%
natures_balance Astral Power 400.35 200.17 (10.10%) 0.50 0.01 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 6.61 6.73
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 22.51 0.00 95.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data visions Damage Per Second
Count 2851
Mean 96443.75
Minimum 90018.09
Maximum 105151.08
Spread ( max - min ) 15132.99
Range [ ( max - min ) / 2 * 100% ] 7.85%
Standard Deviation 2149.4567
5th Percentile 92776.26
95th Percentile 99963.98
( 95th Percentile - 5th Percentile ) 7187.72
Mean Distribution
Standard Deviation 40.2560
95.00% Confidence Intervall ( 96364.85 - 96522.65 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1909
0.1 Scale Factor Error with Delta=300 39441
0.05 Scale Factor Error with Delta=300 157762
0.01 Scale Factor Error with Delta=300 3944038
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 2851
Mean 20173.89
Minimum 18179.93
Maximum 22865.99
Spread ( max - min ) 4686.06
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 691.0204
5th Percentile 19020.07
95th Percentile 21309.50
( 95th Percentile - 5th Percentile ) 2289.43
Mean Distribution
Standard Deviation 12.9417
95.00% Confidence Intervall ( 20148.52 - 20199.26 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4508
0.1 Scale Factor Error with Delta=300 4077
0.05 Scale Factor Error with Delta=300 16306
0.01 Scale Factor Error with Delta=300 407630
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 2851
Mean 96443.75
Minimum 90018.09
Maximum 105151.08
Spread ( max - min ) 15132.99
Range [ ( max - min ) / 2 * 100% ] 7.85%
Damage
Sample Data visions Damage
Count 2851
Mean 28922620.05
Minimum 22811509.10
Maximum 35677229.48
Spread ( max - min ) 12865720.38
Range [ ( max - min ) / 2 * 100% ] 22.24%
DTPS
Sample Data visions Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 1.45 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.45 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.46 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 4.45 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.40 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.05 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.61 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.49 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.39 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 15.91 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 63.72 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 82.22 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 33.95 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.08 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRMQQQKQQQQQQQJKKPPOPPRQRKQRQRQRKPOPPPIPKQQKQQROQKPPPPQPQKQQOQKQQPQPPKPQQOQKQQQRQKPPQPOPQKQQQQKQRPPHEGIKOPRPKPRKRQRQRKRQRQMPPQPQKPQKPQQORKQRPQPQKPRPQOQKRQIRQKPPQKOPPPQQKRQQQKPORQPRPKPPQRQQKOPPQQQKPQPQQKORQPPPQKQQPPOQHFGKIKRQRKPRPRQKRQRQRQRMPKPPQKQQPPORKQQPPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.162 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.087 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.014 default P moonfire enemy4 27.5/100: 28% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.939 default P moonfire enemy5 31.0/100: 31% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:05.864 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:07.250 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:08.054 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, battle_potion_of_intellect
0:08.054 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect
0:08.054 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:08.809 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:09.565 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:10.319 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.072 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:11.827 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse
0:12.821 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.574 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.524 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.278 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.034 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.788 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, lunar_empowerment, starlord(3), starfall, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.542 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), starfall, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.297 default P moonfire enemy3 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.051 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.806 default P moonfire enemy7 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.560 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.315 default P moonfire enemy4 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.070 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.824 default P moonfire enemy5 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.579 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, overwhelming_power(16), ignition_mages_fuse(4)
0:24.333 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, starfall, overwhelming_power(15), ignition_mages_fuse(5)
0:25.087 default P moonfire enemy6 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, overwhelming_power(14), ignition_mages_fuse(5)
0:25.842 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, overwhelming_power(14), ignition_mages_fuse(5)
0:26.598 default M sunfire Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), starfall, overwhelming_power(13), ignition_mages_fuse(5)
0:27.352 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(3), starlord(2), starfall, overwhelming_power(12), ignition_mages_fuse(5)
0:28.258 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), starlord(2), starfall, overwhelming_power(11)
0:29.359 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(2), starfall, overwhelming_power(10)
0:30.462 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(9)
0:31.332 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(8)
0:32.604 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(7)
0:33.880 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(6)
0:35.162 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(4)
0:36.452 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(3)
0:37.748 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(2)
0:39.049 default Q lunar_strike Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, starlord(3)
0:40.359 default J cancel_buff Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3)
0:40.359 default K starfall Fluffy_Pillow 99.5/100: 100% astral_power bloodlust, arcanic_pulsar, solar_empowerment
0:41.314 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
0:42.517 default P moonfire enemy6 1.0/100: 1% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:43.685 default P moonfire enemy2 5.0/100: 5% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:44.852 default O sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:46.019 default P moonfire enemy3 12.5/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:47.187 default P moonfire enemy4 16.0/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:48.356 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
0:49.349 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2)
0:51.099 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
0:52.090 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(2)
0:53.258 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, starlord(3), starfall
0:54.961 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:55.928 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord(3), starfall
0:57.631 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
0:58.599 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3), starfall
1:00.301 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
1:01.268 default K starfall Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, lunar_empowerment, torrent_of_elements
1:02.505 default P moonfire enemy2 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:03.708 default O sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:04.909 default P moonfire enemy3 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:06.111 default P moonfire enemy7 29.0/100: 29% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:07.314 default P moonfire enemy4 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:08.517 default I fury_of_elune Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements
1:09.719 default P moonfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord, torrent_of_elements
1:10.921 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord, torrent_of_elements
1:12.122 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, fury_of_elune, lunar_empowerment, starlord(2), starfall, torrent_of_elements
1:13.609 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements
1:15.360 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements
1:16.529 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, starlord(3), starfall
1:18.231 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, starlord(3), starfall
1:19.935 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
1:20.902 default O sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord(3), starfall
1:22.038 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starfall
1:23.893 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar
1:25.131 default P moonfire enemy2 11.5/100: 12% astral_power arcanic_pulsar, starlord, starfall
1:26.334 default P moonfire enemy6 15.5/100: 16% astral_power arcanic_pulsar, starlord, starfall
1:27.538 default P moonfire enemy7 19.0/100: 19% astral_power arcanic_pulsar, starlord, starfall
1:28.741 default P moonfire enemy5 23.0/100: 23% astral_power arcanic_pulsar, starlord, starfall
1:29.944 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord, starfall
1:31.745 default P moonfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord, starfall
1:32.948 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord
1:34.750 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord
1:35.955 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall
1:37.705 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall
1:39.457 default O sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall
1:40.624 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), starfall
1:42.375 default K starfall Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, starlord(2), starfall
1:43.545 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(3), starfall
1:45.246 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starfall, overwhelming_power(24)
1:46.947 default P moonfire enemy2 28.0/100: 28% astral_power arcanic_pulsar, starfall, overwhelming_power(23)
1:48.086 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starfall, overwhelming_power(21)
1:49.808 default P moonfire enemy4 45.0/100: 45% astral_power arcanic_pulsar, starfall, overwhelming_power(20)
1:50.961 default P moonfire enemy5 48.5/100: 49% astral_power arcanic_pulsar, overwhelming_power(19)
1:52.117 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, overwhelming_power(17)
1:53.281 default P moonfire enemy6 3.5/100: 4% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16)
1:54.416 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(15)
1:56.122 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(13)
1:57.839 default O sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12)
1:58.988 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11)
2:00.718 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, starlord, overwhelming_power(24)
2:01.822 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23)
2:03.435 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(21)
2:05.059 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(19)
2:06.694 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(18)
2:07.624 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, overwhelming_power(25)
2:08.987 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, starlord(2), overwhelming_power(24)
2:10.058 default P moonfire enemy2 12.5/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(22)
2:11.108 default P moonfire enemy7 16.0/100: 16% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(21)
2:12.163 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starfall, overwhelming_power(20)
2:13.891 default P moonfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, starfall, overwhelming_power(19)
2:15.047 default O sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, starfall, overwhelming_power(17)
2:16.211 default P moonfire enemy5 40.5/100: 41% astral_power arcanic_pulsar, starfall, overwhelming_power(16)
2:17.379 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, overwhelming_power(15)
2:19.135 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, overwhelming_power(13)
2:20.315 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12)
2:22.040 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(10)
2:23.777 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9), conch_of_dark_whispers
2:25.521 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(7), conch_of_dark_whispers
2:27.276 default K starfall Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord, overwhelming_power(5), conch_of_dark_whispers
2:28.458 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(4), conch_of_dark_whispers
2:30.181 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(2), conch_of_dark_whispers
2:31.167 default P moonfire enemy7 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power, conch_of_dark_whispers
2:32.331 default P moonfire enemy3 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
2:33.501 default H celestial_alignment Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, conch_of_dark_whispers
2:34.517 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, conch_of_dark_whispers
2:34.517 default G use_items Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect
2:34.517 default I fury_of_elune Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
2:35.490 default K starfall Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
2:36.386 default O sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
2:37.263 default P moonfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
2:38.137 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
2:39.013 default P moonfire enemy5 69.0/100: 69% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
2:39.856 default K starfall Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starfall, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
2:40.778 default P moonfire enemy6 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
2:41.675 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
2:42.576 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, celestial_alignment, starlord, starfall, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
2:43.447 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
2:44.292 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
2:45.539 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
2:46.375 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
2:47.627 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(2), starfall, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(4)
2:48.381 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, starlord(2), starfall, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
2:49.194 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
2:49.986 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
2:51.176 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), starfall, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
2:51.931 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
2:53.084 default M sunfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(5)
2:53.860 default P moonfire enemy4 53.5/100: 54% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(5)
2:54.750 default P moonfire enemy3 57.0/100: 57% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(14), battle_potion_of_intellect
2:55.828 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(13), battle_potion_of_intellect
2:57.451 default P moonfire enemy6 74.0/100: 74% astral_power arcanic_pulsar, starlord(3), overwhelming_power(11), battle_potion_of_intellect
2:58.542 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:00.184 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, overwhelming_power(8)
3:01.386 default P moonfire Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(7)
3:02.558 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(6)
3:04.321 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(4)
3:05.504 default P moonfire enemy7 9.5/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(3)
3:06.659 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(2)
3:08.396 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
3:10.146 default O sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements
3:11.316 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
3:12.311 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, conch_of_dark_whispers
3:13.479 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:15.181 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:16.148 default P moonfire enemy3 24.5/100: 25% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:17.286 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:18.988 default P moonfire enemy6 41.5/100: 42% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:20.125 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, conch_of_dark_whispers
3:21.829 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, conch_of_dark_whispers
3:23.067 default P moonfire enemy5 9.0/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
3:24.270 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
3:25.294 default P moonfire enemy7 21.5/100: 22% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
3:26.496 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
3:28.296 default O sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, conch_of_dark_whispers
3:29.499 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:31.302 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord, conch_of_dark_whispers
3:32.507 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, conch_of_dark_whispers
3:33.500 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord(2), starfall, conch_of_dark_whispers
3:35.251 default I fury_of_elune Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
3:36.419 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, fury_of_elune, solar_empowerment, starlord(2), starfall
3:37.411 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall
3:39.161 default K starfall Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, conch_of_dark_whispers
3:40.330 default P moonfire enemy3 26.5/100: 27% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers
3:41.468 default P moonfire enemy6 35.5/100: 36% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, conch_of_dark_whispers
3:42.605 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, fury_of_elune, starfall, conch_of_dark_whispers
3:44.460 default K starfall Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, starfall, conch_of_dark_whispers
3:45.699 default O sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:46.901 default P moonfire enemy2 17.0/100: 17% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:48.104 default P moonfire enemy5 21.0/100: 21% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:49.307 default P moonfire enemy7 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:50.510 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:52.314 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall, conch_of_dark_whispers
3:54.116 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord
3:55.318 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
3:56.312 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall
3:57.799 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall
3:59.549 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(2), starfall
4:01.302 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
4:02.471 default P moonfire enemy3 4.5/100: 5% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
4:03.607 default O sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall
4:04.744 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, solar_empowerment, starfall
4:05.794 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starfall
4:07.649 default P moonfire enemy2 34.0/100: 34% astral_power arcanic_pulsar, solar_empowerment, starfall
4:08.886 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, solar_empowerment, starfall
4:09.937 default P moonfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar
4:11.174 default K starfall Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar
4:12.411 default P moonfire enemy4 1.0/100: 1% astral_power arcanic_pulsar, starlord, starfall
4:13.613 default P moonfire enemy5 5.0/100: 5% astral_power arcanic_pulsar, starlord, starfall
4:14.816 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, starlord, starfall
4:16.619 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall
4:17.642 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord, starfall
4:19.444 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starlord
4:21.245 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord
4:22.446 default O sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall
4:23.615 default P moonfire enemy3 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall
4:24.783 default P moonfire enemy6 15.5/100: 16% astral_power arcanic_pulsar, starlord(2), starfall
4:25.952 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, starlord(2), starfall
4:27.703 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25)
4:29.303 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), overwhelming_power(23)
4:30.917 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2), overwhelming_power(22)
4:31.996 default P moonfire enemy2 9.0/100: 9% astral_power arcanic_pulsar, starfall, overwhelming_power(21)
4:33.144 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starfall, overwhelming_power(19)
4:34.876 default P moonfire enemy5 26.0/100: 26% astral_power arcanic_pulsar, starfall, overwhelming_power(18)
4:36.036 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starfall, overwhelming_power(16)
4:37.787 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starfall, overwhelming_power(15)
4:39.543 default K starfall Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(13)
4:40.725 default O sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(12)
4:41.876 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(11)
4:42.858 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(10)
4:44.594 default P moonfire enemy3 32.5/100: 33% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(8)
4:45.762 default P moonfire enemy7 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(7)
4:46.934 default P moonfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(6)
4:48.109 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(4)
4:49.885 default K starfall Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(3)
4:51.077 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power
4:52.821 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
4:54.570 default P moonfire enemy4 34.0/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
4:55.739 default P moonfire enemy5 38.0/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
4:56.906 default O sunfire Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements
4:58.073 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), torrent_of_elements
4:59.824 default H celestial_alignment Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment
5:00.900 default F berserking Fluffy_Pillow 99.5/100: 100% astral_power arcanic_pulsar, celestial_alignment
5:00.900 default G use_items Fluffy_Pillow 99.5/100: 100% astral_power berserking, arcanic_pulsar, celestial_alignment
5:00.900 default K starfall Fluffy_Pillow 99.5/100: 100% astral_power berserking, arcanic_pulsar, celestial_alignment, ignition_mages_fuse
5:01.838 default I fury_of_elune Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord, starfall, ignition_mages_fuse
5:02.749 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, ignition_mages_fuse
5:03.659 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, ignition_mages_fuse
5:04.545 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, ignition_mages_fuse
5:05.873 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, ignition_mages_fuse(2)
5:06.721 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(2), starfall, ignition_mages_fuse(2)
5:07.570 default P moonfire enemy2 9.5/100: 10% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(2)
5:08.396 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(2)
5:09.222 default P moonfire enemy3 29.0/100: 29% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, lunar_empowerment(2), starlord(3), starfall, ignition_mages_fuse(3)
5:10.019 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, ignition_mages_fuse(3)
5:10.813 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), starfall, ignition_mages_fuse(3)
5:11.824 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, ignition_mages_fuse(3)
5:12.618 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, ignition_mages_fuse(3)
5:13.373 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(4)
5:14.441 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, ignition_mages_fuse(4)
5:15.282 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, ignition_mages_fuse(4)
5:16.541 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, ignition_mages_fuse(4)
5:17.381 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, ignition_mages_fuse(5)
5:18.414 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), starfall, ignition_mages_fuse(5)
5:19.168 default M sunfire Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, ignition_mages_fuse(5)
5:19.979 default P moonfire enemy4 85.0/100: 85% astral_power arcanic_pulsar, starlord(3), ignition_mages_fuse(5)
5:20.911 default K starfall Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar
5:22.148 default P moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, starlord, starfall
5:23.350 default P moonfire enemy5 43.5/100: 44% astral_power arcanic_pulsar, starlord, starfall
5:24.553 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord, starfall
5:26.354 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, starlord, starfall
5:27.556 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall
5:29.307 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall
5:31.058 default P moonfire enemy3 37.5/100: 38% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:32.226 default P moonfire enemy2 41.0/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:33.394 default O sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall
5:34.564 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(2)
5:35.559 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, lunar_empowerment, starlord(2)
5:36.728 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall
5:38.176 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, starlord(3), starfall
5:39.879 default P moonfire enemy5 34.5/100: 35% astral_power arcanic_pulsar, starlord(3), starfall
5:41.015 default P moonfire enemy7 38.0/100: 38% astral_power arcanic_pulsar, starfall
5:42.252 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starfall

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 102323 dps, 20723 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
102323.1 102323.1 88.8 / 0.087% 9287.8 / 9.1% 15098.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.8 6.6 Astral Power 0.00% 50.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Twin Moons (Balance Druid)
  • 100: Fury of Elune (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 102323
Fury of Elune 6258 6.1% 5.3 61.18sec 353912 345640 Direct 891.7 1769 3535 2098 18.6%  

Stats details: fury_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 891.71 136.99 0.00 1.0240 0.3047 1870604.47 1870604.47 0.00 39672.64 345640.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 725.84 81.40% 1769.40 1457 2133 1771.27 1688 1943 1284280 1284280 0.00
crit 165.86 18.60% 3535.01 2915 4267 3537.76 3315 3928 586324 586324 0.00
 
 

Action details: fury_of_elune

Static Values
  • id:202770
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
Spelldata
  • id:202770
  • name:Fury of Elune
  • school:astral
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:0.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Heed My Call 286 (1141) 0.3% (1.1%) 7.9 34.52sec 43318 0 Direct 7.9 9128 18248 10850 18.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 7.90 0.00 0.00 0.0000 0.0000 85698.61 85698.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 81.14% 9128.47 8921 9813 9125.05 0 9813 58509 58509 0.00
crit 1.49 18.86% 18248.17 17842 19626 14414.40 0 19626 27189 27189 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 855 0.8% 7.9 34.52sec 32469 0 Direct 55.3 3912 7824 4638 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 55.30 0.00 0.00 0.0000 0.0000 256496.94 256496.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.03 81.42% 3911.77 3823 4206 3911.37 3823 4206 176127 176127 0.00
crit 10.27 18.58% 7824.41 7646 8411 7820.14 0 8411 80370 80370 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 11892 11.6% 82.9 3.55sec 43012 27062 Direct 580.3 5177 10342 6145 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.90 580.28 0.00 0.00 1.5894 0.0000 3565542.81 3565542.81 0.00 27061.71 27061.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.59 81.27% 5177.17 3345 25993 5181.31 4809 5737 2441462 2441462 0.00
crit 108.69 18.73% 10342.46 6689 51987 10350.07 8765 13076 1124081 1124081 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 22663 22.2% 64.3 4.59sec 105520 97363 Direct 128.6 3725 7454 4423 18.7%  
Periodic 1494.8 3504 7004 4160 18.7% 689.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.32 128.64 1494.84 1494.84 1.0838 1.3840 6787056.18 6787056.18 0.00 3173.69 97362.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.58 81.30% 3725.44 3280 4801 3726.80 3614 3919 389618 389618 0.00
crit 24.06 18.70% 7453.71 6689 9602 7456.18 7057 8299 179313 179313 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1214.9 81.27% 3504.23 3 4470 3505.77 3423 3641 4257100 4257100 0.00
crit 280.0 18.73% 7004.11 9 8940 7006.81 6791 7332 1961026 1961026 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Solar Wrath 1249 (4510) 1.2% (4.4%) 31.5 8.99sec 42808 48850 Direct 32.4 9690 19399 11475 18.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.53 32.42 0.00 0.00 0.8763 0.0000 371949.51 371949.51 0.00 48849.81 48849.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.46 81.62% 9689.63 7949 11636 9700.67 9195 10445 256363 256363 0.00
crit 5.96 18.38% 19399.10 16212 23272 19404.13 0 23272 115586 115586 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 3261 3.2% 17.4 16.23sec 56238 0 Direct 121.7 8034 0 8034 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.39 121.72 0.00 0.00 0.0000 0.0000 977868.48 977868.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.72 100.00% 8033.81 6080 17454 8046.05 6552 11197 977868 977868 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12868.61
  • base_dd_max:12868.61
  • base_dd_mult:1.00
 
Starfall 31779 31.1% 39.5 7.61sec 241243 224220 Periodic 2464.9 3254 6507 3861 18.7% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.45 0.00 0.00 2464.89 1.0759 0.0000 9517460.59 9517460.59 0.00 224219.86 224219.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2004.6 81.33% 3253.65 2838 4154 3255.07 3180 3375 6522185 6522185 0.00
crit 460.3 18.67% 6507.32 5675 8307 6509.80 6307 6812 2995276 2995276 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
 
Starsurge 328 0.3% 1.4 265.66sec 68883 79905 Direct 1.2 66301 132943 78521 18.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.40 1.23 0.00 0.00 0.8621 0.0000 96764.96 96764.96 0.00 79905.01 79905.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.01 81.67% 66300.96 53222 74359 56791.72 0 74359 66719 66719 0.00
crit 0.23 18.33% 132942.59 106444 148718 28807.59 0 148718 30046 30046 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Streaking Star (s) 2954 2.9% 45.0 4.61sec 19425 0 Direct 45.0 16390 32789 19424 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 0.0000 0.0000 873793.04 873793.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.66 81.49% 16390.05 16021 17623 16389.97 16021 17623 600813 600813 0.00
crit 8.33 18.51% 32788.95 32042 35246 32784.71 32042 35246 272980 272980 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 20798 20.3% 18.5 16.37sec 336627 320716 Direct 18.5 4755 9508 5639 18.6%  
Periodic 1507.5 3422 6843 4062 18.7% 695.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.50 18.50 1507.54 1507.54 1.0496 1.3831 6227665.88 6227665.88 0.00 2959.17 320716.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.06 81.39% 4755.15 4112 6020 4757.30 4495 5127 71603 71603 0.00
crit 3.44 18.61% 9507.83 8387 12040 9304.05 0 12040 32731 32731 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1225.7 81.30% 3422.36 66 4364 3423.85 3341 3555 4194775 4194775 0.00
crit 281.8 18.70% 6842.89 133 8729 6845.51 6649 7236 1928558 1928558 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 184.19sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.97sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9083 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 1.0 0.2 0.0sec 266.8sec 94.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:93.33%
  • arcanic_pulsar_2:0.84%
  • arcanic_pulsar_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.9sec 0.0sec 16.23% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 184.0sec 184.0sec 8.11% 8.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.0 0.0 183.7sec 183.7sec 13.52% 19.11% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.2sec 45.5sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of Elune 5.3 0.0 61.1sec 61.1sec 13.93% 0.00% 83.5(83.5) 5.2

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_fury_of_elune
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • fury_of_elune_1:13.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202770
  • name:Fury of Elune
  • tooltip:Generating ${$m3/10/$t3*{$d=8 seconds}} Astral Power over {$d=8 seconds}.
  • description:Calls down a beam of pure celestial energy that follows the enemy, dealing $<dmg> Astral damage over {$d=8 seconds} to all nearby targets. |cFFFFFFFFGenerates ${$m3/10/$t3*{$d=8 seconds}} Astral Power over its duration.|r
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.5sec 120.5sec 19.00% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.92%
  • ignition_mages_fuse_2:3.86%
  • ignition_mages_fuse_3:3.80%
  • ignition_mages_fuse_4:3.74%
  • ignition_mages_fuse_5:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 88.7 0.0 149.9sec 3.3sec 98.27% 0.00% 74.8(79.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:1.46%
  • lifeblood_2:2.24%
  • lifeblood_3:6.41%
  • lifeblood_4:88.16%

Trigger Attempt Success

  • trigger_pct:94.20%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 6.3 1.6 47.3sec 37.0sec 9.31% 8.93% 0.1(0.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:6.96%
  • lunar_empowerment_2:1.81%
  • lunar_empowerment_3:0.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.4 3.3 66.3sec 35.2sec 46.49% 0.00% 3.3(45.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.34%
  • overwhelming_power_2:1.37%
  • overwhelming_power_3:1.41%
  • overwhelming_power_4:1.45%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.54%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.62%
  • overwhelming_power_9:1.67%
  • overwhelming_power_10:1.72%
  • overwhelming_power_11:1.77%
  • overwhelming_power_12:1.82%
  • overwhelming_power_13:1.87%
  • overwhelming_power_14:1.92%
  • overwhelming_power_15:1.98%
  • overwhelming_power_16:2.04%
  • overwhelming_power_17:2.10%
  • overwhelming_power_18:2.16%
  • overwhelming_power_19:2.22%
  • overwhelming_power_20:2.29%
  • overwhelming_power_21:2.35%
  • overwhelming_power_22:2.43%
  • overwhelming_power_23:2.50%
  • overwhelming_power_24:2.56%
  • overwhelming_power_25:1.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 17.9 0.1 16.4sec 16.3sec 12.78% 53.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:12.72%
  • solar_empowerment_2:0.05%
  • solar_empowerment_3:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starfall 20.8 18.6 14.6sec 7.6sec 88.04% 0.00% 18.6(18.6) 20.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starfall_1:88.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191034
  • name:Starfall
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 13.8 27.1 22.6sec 7.4sec 88.22% 85.58% 1.2(1.2) 11.5

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:32.92%
  • starlord_2:31.01%
  • starlord_3:24.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.66%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starfall Astral Power 39.5 1972.6 50.0 50.0 4824.9
starsurge Astral Power 1.4 56.2 40.0 40.0 1721.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 32.54 260.26 (13.06%) 8.00 0.03 0.01%
celestial_alignment Astral Power 2.00 80.00 (4.02%) 40.00 0.00 0.00%
fury_of_elune Astral Power 83.45 208.62 (10.47%) 2.50 0.00 0.00%
sunfire Astral Power 18.50 55.50 (2.79%) 3.00 0.00 0.00%
moonfire Astral Power 64.32 192.96 (9.69%) 3.00 0.00 0.00%
lunar_strike Astral Power 82.90 994.74 (49.93%) 12.00 0.02 0.00%
natures_balance Astral Power 400.35 200.16 (10.05%) 0.50 0.01 0.01%
Resource RPS-Gain RPS-Loss
Astral Power 6.64 6.77
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.56 0.00 59.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data worldvein Damage Per Second
Count 2851
Mean 102323.09
Minimum 95598.35
Maximum 110705.61
Spread ( max - min ) 15107.26
Range [ ( max - min ) / 2 * 100% ] 7.38%
Standard Deviation 2419.3442
5th Percentile 98513.54
95th Percentile 106350.16
( 95th Percentile - 5th Percentile ) 7836.62
Mean Distribution
Standard Deviation 45.3105
95.00% Confidence Intervall ( 102234.28 - 102411.89 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2148
0.1 Scale Factor Error with Delta=300 49967
0.05 Scale Factor Error with Delta=300 199867
0.01 Scale Factor Error with Delta=300 4996651
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 2851
Mean 20723.07
Minimum 18707.55
Maximum 23432.31
Spread ( max - min ) 4724.76
Range [ ( max - min ) / 2 * 100% ] 11.40%
Standard Deviation 777.6262
5th Percentile 19518.18
95th Percentile 22038.44
( 95th Percentile - 5th Percentile ) 2520.26
Mean Distribution
Standard Deviation 14.5637
95.00% Confidence Intervall ( 20694.52 - 20751.61 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5410
0.1 Scale Factor Error with Delta=300 5163
0.05 Scale Factor Error with Delta=300 20649
0.01 Scale Factor Error with Delta=300 516209
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 2851
Mean 102323.09
Minimum 95598.35
Maximum 110705.61
Spread ( max - min ) 15107.26
Range [ ( max - min ) / 2 * 100% ] 7.38%
Damage
Sample Data worldvein Damage
Count 2851
Mean 30630901.48
Minimum 24237721.58
Maximum 37266636.36
Spread ( max - min ) 13028914.77
Range [ ( max - min ) / 2 * 100% ] 21.27%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
0.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
E 1.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
I 5.29 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 1.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
K 39.45 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
L 1.41 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
M 1.37 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
N 0.29 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
O 16.06 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 64.03 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
0.00 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 83.53 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 31.58 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 1.06 sunfire

Sample Sequence

012345678ACDKOPPPPQHFGIKRKRQRQORSLRPRPKPRPRKPRQQQKQQQOQQQRJKPPKPPQPQQKOQQRQKPPQQIPKOPPQKQQQKRPQROQKPPQPPQQKQQOPQKQQPPPPQKQOQGIQKQQKPQPPPKOQQQQRKQQQKPPOPPQRQKQQQKQROQPPPKPPQQQHEFIKRKORQKRQRPKPRPRQRMPPKQRQRKQRPPPPOQKRQQRKQRQQGKOPPPIPQKQQQKQROQKQPPPPRQKQQQOQKRQRQKPPPPPQQKOQQRQKIPQPKOPPPQRKQRQQKQQOPPLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starfall Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default O sunfire Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:02.164 default P moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:03.090 default P moonfire enemy2 24.0/100: 24% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.016 default P moonfire enemy3 27.5/100: 28% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:04.941 default P moonfire enemy6 31.0/100: 31% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:05.868 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, starlord, starfall, battle_potion_of_intellect
0:07.254 default H celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, celestial_alignment, starlord, starfall, battle_potion_of_intellect
0:08.060 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, celestial_alignment, starlord, torrent_of_elements, battle_potion_of_intellect
0:08.060 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, torrent_of_elements, battle_potion_of_intellect
0:08.060 default I fury_of_elune Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, celestial_alignment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.813 default K starfall Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord, torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:09.568 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(24), lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:10.323 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(23), lifeblood, battle_potion_of_intellect, ignition_mages_fuse
0:11.078 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(22), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:11.833 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(22), lifeblood(2), battle_potion_of_intellect, ignition_mages_fuse
0:12.756 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(21), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.511 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(20), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.403 default O sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(19), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.157 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(18), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.912 default S sunfire Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(18), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.667 default L starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, berserking, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(17), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.421 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(16), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.174 default P moonfire Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(15), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.927 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.681 default P moonfire enemy4 77.0/100: 77% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.434 default K starfall Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(13), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.188 default P moonfire enemy5 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.943 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.698 default P moonfire enemy6 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(11), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.453 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(10), lifeblood(4), ignition_mages_fuse(4)
0:24.208 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, starfall, overwhelming_power(9), lifeblood(4), ignition_mages_fuse(5)
0:24.963 default P moonfire enemy7 5.5/100: 6% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(9), lifeblood(4), ignition_mages_fuse(5)
0:25.719 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(8), lifeblood(4), ignition_mages_fuse(5)
0:26.474 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), starfall, overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
0:27.275 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(6), lifeblood(4), ignition_mages_fuse(5)
0:28.359 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(5), lifeblood(4)
0:29.681 default K starfall Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, starlord(2), starfall, overwhelming_power(4), lifeblood(4)
0:30.569 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(3), lifeblood(4)
0:31.865 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, overwhelming_power(2), lifeblood(4)
0:33.167 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, lifeblood(4)
0:34.477 default O sunfire Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, lifeblood(4), conch_of_dark_whispers
0:35.352 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, lifeblood(4), conch_of_dark_whispers
0:36.663 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, starlord(3), starfall, lifeblood(4), conch_of_dark_whispers
0:37.974 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar, starlord(3), lifeblood(4), conch_of_dark_whispers
0:39.283 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:40.037 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
0:40.037 default K starfall Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, lifeblood(4), conch_of_dark_whispers
0:40.989 default P moonfire enemy7 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord, starfall, lifeblood(4), conch_of_dark_whispers
0:41.916 default P moonfire enemy4 49.5/100: 50% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, lifeblood(4), conch_of_dark_whispers
0:43.120 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, lifeblood(4), conch_of_dark_whispers
0:44.323 default P moonfire enemy5 4.5/100: 5% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
0:45.491 default P moonfire enemy6 8.0/100: 8% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
0:46.661 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
0:48.150 default P moonfire enemy3 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
0:49.319 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
0:51.072 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
0:52.823 default K starfall Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, starlord(2), lifeblood(4)
0:53.992 default O sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4)
0:55.128 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4)
0:56.830 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4)
0:58.533 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, lifeblood(4)
0:59.500 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall, lifeblood(4)
1:00.948 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, lifeblood(4)
1:02.188 default P moonfire enemy4 8.0/100: 8% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:03.391 default P moonfire enemy7 12.0/100: 12% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4), conch_of_dark_whispers
1:04.593 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4), conch_of_dark_whispers
1:06.394 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4), conch_of_dark_whispers
1:08.196 default I fury_of_elune Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
1:09.301 default P moonfire enemy3 48.0/100: 48% astral_power arcanic_pulsar, fury_of_elune, starlord, overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
1:10.409 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, fury_of_elune, starlord, overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
1:11.521 default O sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
1:12.604 default P moonfire enemy5 21.0/100: 21% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
1:13.691 default P moonfire enemy6 30.0/100: 30% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
1:14.785 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
1:16.424 default K starfall Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
1:17.528 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
1:19.141 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(13), lifeblood(4)
1:20.766 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), lifeblood(4)
1:22.394 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, overwhelming_power(10), lifeblood(4)
1:23.587 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(9), lifeblood(4)
1:24.577 default P moonfire enemy7 11.0/100: 11% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(25), lifeblood(4)
1:25.676 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(24), lifeblood(4)
1:27.329 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(22), lifeblood(4)
1:28.273 default O sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(21), lifeblood(4)
1:29.388 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(20), lifeblood(4)
1:31.064 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord, torrent_of_elements, overwhelming_power(18), lifeblood(4)
1:32.192 default P moonfire enemy3 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), lifeblood(4)
1:33.292 default P moonfire enemy6 8.0/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(16), lifeblood(4)
1:34.395 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(15), lifeblood(4)
1:36.054 default P moonfire enemy2 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), lifeblood(4)
1:37.168 default P moonfire enemy4 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12), lifeblood(4)
1:38.286 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), lifeblood(4)
1:39.966 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(2), overwhelming_power(10), lifeblood(4)
1:41.653 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, starlord(2), overwhelming_power(8), lifeblood(4)
1:42.786 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starfall, overwhelming_power(7), lifeblood(4)
1:44.594 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, starfall, overwhelming_power(5), lifeblood(4)
1:46.416 default O sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, starfall, overwhelming_power(3), lifeblood(3)
1:47.638 default P moonfire enemy7 39.5/100: 40% astral_power arcanic_pulsar, starfall, overwhelming_power(2), lifeblood(4)
1:48.867 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starfall, overwhelming_power, lifeblood(4)
1:50.717 default K starfall Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, lifeblood(4)
1:51.956 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:53.757 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:55.558 default P moonfire enemy6 34.0/100: 34% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:56.764 default P moonfire enemy2 37.5/100: 38% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:57.966 default P moonfire enemy4 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
1:59.168 default P moonfire enemy5 45.0/100: 45% astral_power arcanic_pulsar, starlord, lifeblood(4)
2:00.371 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, starlord, lifeblood(4)
2:02.171 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord, lifeblood(4)
2:03.374 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
2:05.123 default O sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
2:06.292 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
2:08.043 default G use_items Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
2:08.043 default I fury_of_elune Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse
2:09.316 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, lifeblood(4), ignition_mages_fuse
2:10.992 default K starfall Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, fury_of_elune, lifeblood(4), ignition_mages_fuse
2:12.177 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(4), ignition_mages_fuse(2)
2:13.832 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(3), ignition_mages_fuse(2)
2:15.490 default K starfall Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(3), ignition_mages_fuse(2)
2:16.595 default P moonfire enemy6 25.0/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(3)
2:17.627 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(3)
2:19.171 default P moonfire enemy2 41.5/100: 42% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(3)
2:20.200 default P moonfire enemy7 45.0/100: 45% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(4)
2:21.192 default P moonfire enemy3 49.0/100: 49% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(4)
2:22.185 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), ignition_mages_fuse(4)
2:23.178 default O sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4), ignition_mages_fuse(4)
2:24.144 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4), ignition_mages_fuse(5)
2:25.538 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4), ignition_mages_fuse(5)
2:26.933 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4), ignition_mages_fuse(5)
2:28.330 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), starfall, lifeblood(4)
2:30.033 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, lifeblood(4)
2:31.000 default K starfall Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar, lunar_empowerment, lifeblood(4)
2:32.238 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, lifeblood(4)
2:33.769 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
2:35.571 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
2:37.374 default K starfall Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
2:38.577 default P moonfire enemy6 8.5/100: 9% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:39.746 default P moonfire enemy4 12.0/100: 12% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:40.915 default O sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:42.085 default P moonfire enemy7 20.0/100: 20% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:43.253 default P moonfire enemy5 23.5/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:44.422 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4), conch_of_dark_whispers
2:46.174 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
2:47.086 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
2:48.457 default K starfall Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, starlord(2), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
2:49.535 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
2:51.113 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, starfall, overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
2:52.845 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starfall, overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
2:54.584 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starfall, overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
2:55.752 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
2:57.457 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
2:58.431 default O sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(12), lifeblood(4), conch_of_dark_whispers
2:59.581 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(11), lifeblood(4), conch_of_dark_whispers
3:01.311 default P moonfire enemy2 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(9), lifeblood(4)
3:02.475 default P moonfire enemy3 45.5/100: 46% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(8), lifeblood(4)
3:03.643 default P moonfire enemy6 49.0/100: 49% astral_power arcanic_pulsar, starlord, overwhelming_power(7), lifeblood(4)
3:04.816 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, overwhelming_power(6), lifeblood(4)
3:05.994 default P moonfire enemy5 3.5/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), lifeblood(4)
3:07.063 default P moonfire enemy7 7.5/100: 8% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), lifeblood(4)
3:08.141 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(22), lifeblood(4)
3:09.760 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(25), lifeblood(4)
3:11.360 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(23), lifeblood(4)
3:12.974 default H celestial_alignment Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(22), lifeblood(4)
3:13.912 default E potion Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(21), lifeblood(4)
3:13.912 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:13.912 default I fury_of_elune Fluffy_Pillow 91.0/100: 91% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:14.770 default K starfall Fluffy_Pillow 94.0/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:15.682 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:16.571 default K starfall Fluffy_Pillow 63.5/100: 64% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord, starfall, torrent_of_elements, overwhelming_power(18), lifeblood(4), battle_potion_of_intellect
3:17.463 default O sunfire Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), lifeblood(4), battle_potion_of_intellect
3:18.333 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(16), lifeblood(4), battle_potion_of_intellect
3:19.205 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(15), lifeblood(4), battle_potion_of_intellect
3:20.516 default K starfall Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(2), starfall, torrent_of_elements, overwhelming_power(14), lifeblood(4), battle_potion_of_intellect
3:21.396 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power berserking, arcanic_pulsar, celestial_alignment, fury_of_elune, starlord(3), starfall, torrent_of_elements, overwhelming_power(13), lifeblood(4), battle_potion_of_intellect
3:22.255 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect
3:23.546 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(11), lifeblood(4), battle_potion_of_intellect
3:24.408 default P moonfire enemy3 47.0/100: 47% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(10), lifeblood(4), battle_potion_of_intellect
3:25.275 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(9), lifeblood(4), battle_potion_of_intellect
3:26.146 default P moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(8), lifeblood(4), battle_potion_of_intellect
3:27.106 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(7), lifeblood(4), battle_potion_of_intellect
3:28.066 default P moonfire enemy4 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(6), lifeblood(4), battle_potion_of_intellect
3:29.035 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(5), lifeblood(4), battle_potion_of_intellect
3:30.005 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(4), lifeblood(4), battle_potion_of_intellect
3:31.465 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(3), lifeblood(4), battle_potion_of_intellect
3:32.444 default M sunfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, celestial_alignment, starlord(3), starfall, torrent_of_elements, overwhelming_power(2), lifeblood(4), battle_potion_of_intellect
3:33.425 default P moonfire enemy2 51.0/100: 51% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power, lifeblood(4), battle_potion_of_intellect
3:34.557 default P moonfire enemy5 55.0/100: 55% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:35.691 default K starfall Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:36.930 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:38.730 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), battle_potion_of_intellect
3:39.754 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4)
3:41.556 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4)
3:42.579 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4)
3:43.781 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(3)
3:45.532 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, lifeblood(3)
3:46.526 default P moonfire enemy3 26.0/100: 26% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(3)
3:47.693 default P moonfire enemy4 29.5/100: 30% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
3:48.862 default P moonfire enemy6 33.5/100: 34% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
3:50.031 default P moonfire enemy2 37.0/100: 37% astral_power arcanic_pulsar, starlord(2), starfall, lifeblood(4)
3:51.199 default O sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, starlord(2), lifeblood(4)
3:52.365 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, starlord(2), lifeblood(4)
3:54.117 default K starfall Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(2), lifeblood(4)
3:55.287 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, lifeblood(4)
3:56.253 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starfall, torrent_of_elements, lifeblood(4)
3:58.108 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starfall, torrent_of_elements, lifeblood(4)
3:59.964 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starfall, torrent_of_elements, lifeblood(4)
4:01.018 default K starfall Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starfall, torrent_of_elements, lifeblood(4)
4:02.256 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4)
4:04.060 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:05.082 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:06.615 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:08.416 default G use_items Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
4:08.416 default K starfall Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:09.568 default O sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:10.689 default P moonfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:11.808 default P moonfire enemy4 9.5/100: 10% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse
4:12.927 default P moonfire enemy2 13.5/100: 14% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.001 default I fury_of_elune Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:15.075 default P moonfire enemy5 23.0/100: 23% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:16.149 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:17.756 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, fury_of_elune, starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.788 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(3)
4:20.292 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, fury_of_elune, starlord(3), starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
4:21.796 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, fury_of_elune, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(4)
4:23.373 default K starfall Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(4)
4:24.424 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:25.899 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:26.737 default O sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:27.724 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, lunar_empowerment, starlord, starfall, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:28.979 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(25), lifeblood(4)
4:30.077 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(23), lifeblood(4)
4:31.690 default P moonfire Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(22), lifeblood(4)
4:32.768 default P moonfire enemy3 20.5/100: 21% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(21), lifeblood(4)
4:33.852 default P moonfire enemy6 24.5/100: 25% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(20), lifeblood(4)
4:34.940 default P moonfire enemy2 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, overwhelming_power(19), lifeblood(4)
4:36.031 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), lifeblood(4)
4:36.965 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, overwhelming_power(17), lifeblood(4)
4:38.611 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, overwhelming_power(15), lifeblood(4)
4:39.716 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(14), lifeblood(4)
4:41.335 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(12), lifeblood(4)
4:42.964 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, overwhelming_power(11), lifeblood(4), conch_of_dark_whispers
4:44.600 default O sunfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
4:45.798 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
4:47.496 default K starfall Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, solar_empowerment, torrent_of_elements, overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
4:48.638 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, torrent_of_elements, overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
4:49.584 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
4:51.255 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, solar_empowerment, starlord, starfall, overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
4:52.211 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
4:53.899 default K starfall Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
4:55.030 default P moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
4:56.136 default P moonfire enemy2 9.0/100: 9% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
4:57.246 default P moonfire enemy3 13.0/100: 13% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
4:58.358 default P moonfire enemy5 16.5/100: 17% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(12), lifeblood(4)
4:59.476 default P moonfire enemy6 20.5/100: 21% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(11), lifeblood(4)
5:00.599 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, overwhelming_power(10), lifeblood(4)
5:02.287 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, starlord(2), overwhelming_power(8), lifeblood(4)
5:03.986 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(2), overwhelming_power(7), lifeblood(4)
5:05.124 default O sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(5), lifeblood(4)
5:06.239 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, starlord(3), starfall, overwhelming_power(4), lifeblood(4)
5:07.915 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, starfall, overwhelming_power(3), lifeblood(4)
5:09.750 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment, starfall, overwhelming_power, lifeblood(4)
5:10.797 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, starfall, lifeblood(4)
5:12.653 default K starfall Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, lifeblood(4)
5:13.892 default I fury_of_elune Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord, starfall, lifeblood(4)
5:15.205 default P moonfire enemy6 10.0/100: 10% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(4)
5:16.408 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(4)
5:18.211 default P moonfire enemy3 42.0/100: 42% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(4)
5:19.413 default K starfall Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, fury_of_elune, starlord, starfall, lifeblood(4)
5:20.616 default O sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, lifeblood(4)
5:21.784 default P moonfire enemy2 18.0/100: 18% astral_power arcanic_pulsar, fury_of_elune, starlord(2), starfall, lifeblood(4)
5:22.952 default P moonfire enemy5 24.0/100: 24% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4)
5:24.120 default P moonfire enemy7 28.0/100: 28% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4)
5:25.290 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, starlord(2), starfall, torrent_of_elements, lifeblood(4)
5:27.040 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(2), starfall, torrent_of_elements, lifeblood(4)
5:28.034 default K starfall Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, lifeblood(4)
5:29.202 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, starlord(3), starfall, torrent_of_elements, lifeblood(4)
5:30.905 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, solar_empowerment, starlord(3), starfall, torrent_of_elements, lifeblood(4)
5:31.871 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), starfall, torrent_of_elements, overwhelming_power(25), lifeblood(4)
5:33.196 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(23), lifeblood(4)
5:34.905 default K starfall Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, starfall, torrent_of_elements, overwhelming_power(22), lifeblood(4)
5:36.050 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, starlord, starfall, torrent_of_elements, overwhelming_power(20), lifeblood(4)
5:37.726 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(19), lifeblood(4)
5:39.407 default O sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(17), lifeblood(4)
5:40.537 default P moonfire enemy7 33.0/100: 33% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
5:41.671 default P moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
5:42.812 default L starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, starlord, starfall, overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
5:43.953 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000222
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 2857
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.9 )

Performance:

Total Events Processed: 190444739
Max Event Queue: 770
Sim Seconds: 856789
CPU Seconds: 266.7969
Physical Seconds: 56.0142
Speed Up: 3211

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.10sec 0 299.89sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.87sec 0 299.89sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
base base fury_of_elune 202770 1755202 5853 178.38 1660 3315 5.3 891.6 18.6% 0.0% 0.0% 0.0% 61.15sec 1755202 299.89sec
base base heed_my_call 271685 85913 286 1.58 9125 18256 7.9 7.9 18.9% 0.0% 0.0% 0.0% 33.57sec 85913 299.89sec
base base heed_my_call_aoe 271686 257139 857 11.09 3911 7821 7.9 55.4 18.7% 0.0% 0.0% 0.0% 33.57sec 257139 299.89sec
base base lunar_strike 194153 3317271 11062 116.13 4810 9638 82.9 580.4 18.7% 0.0% 0.0% 0.0% 3.54sec 3317271 299.89sec
base base moonfire 8921 530145 1768 25.73 3475 6948 64.3 128.6 18.6% 0.0% 0.0% 0.0% 4.61sec 6321026 299.89sec
base base moonfire ticks -8921 5790881 19303 298.99 3262 6522 64.3 1494.9 18.8% 0.0% 0.0% 0.0% 4.61sec 6321026 299.89sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
base base solar_wrath 190984 348406 1162 6.49 9069 18128 31.5 32.4 18.5% 0.0% 0.0% 0.0% 9.05sec 348406 299.89sec
base base solar_empowerment 279729 905169 3018 24.21 7481 0 17.3 121.0 0.0% 0.0% 0.0% 0.0% 16.55sec 905169 299.89sec
base base starfall ticks -191034 8866484 29555 0.00 3030 6058 39.5 0.0 18.7% 0.0% 0.0% 0.0% 7.61sec 8866484 299.89sec
base base starsurge 78674 91451 305 0.24 62781 125337 1.4 1.2 19.5% 0.0% 0.0% 0.0% 268.66sec 91451 299.89sec
base base streaking_stars 272873 872515 2909 9.00 16374 32760 45.0 45.0 18.4% 0.0% 0.0% 0.0% 4.60sec 872515 299.89sec
base base sunfire 93402 97266 324 3.70 4439 8885 18.5 18.5 18.5% 0.0% 0.0% 0.0% 16.38sec 5804335 299.89sec
base base sunfire ticks -93402 5707069 19024 301.53 3188 6372 18.5 1507.6 18.8% 0.0% 0.0% 0.0% 16.38sec 5804335 299.89sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.89sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.45sec 0 299.89sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
blood of the enemy blood of the enemy fury_of_elune 202770 1814681 6051 181.41 1659 3319 5.3 906.7 20.6% 0.0% 0.0% 0.0% 60.84sec 1814681 299.89sec
blood of the enemy blood of the enemy heed_my_call 271685 89002 297 1.62 9127 18269 8.1 8.1 20.2% 0.0% 0.0% 0.0% 32.91sec 89002 299.89sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 268023 894 11.36 3912 7826 8.1 56.8 20.6% 0.0% 0.0% 0.0% 32.91sec 268023 299.89sec
blood of the enemy blood of the enemy lunar_strike 194153 3511059 11708 120.94 4810 9644 86.4 604.5 20.7% 0.0% 0.0% 0.0% 3.41sec 3511059 299.89sec
blood of the enemy blood of the enemy moonfire 8921 536531 1789 25.72 3472 6939 64.3 128.5 20.3% 0.0% 0.0% 0.0% 4.60sec 6571794 299.89sec
blood of the enemy blood of the enemy moonfire ticks -8921 6035263 20118 306.77 3265 6522 64.3 1533.8 20.6% 0.0% 0.0% 0.0% 4.60sec 6571794 299.89sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
blood of the enemy blood of the enemy solar_wrath 190984 359522 1199 6.60 9061 18103 32.1 33.0 20.3% 0.0% 0.0% 0.0% 8.88sec 359522 299.89sec
blood of the enemy blood of the enemy solar_empowerment 279729 957298 3192 25.16 7613 0 18.0 125.7 0.0% 0.0% 0.0% 0.0% 15.74sec 957298 299.89sec
blood of the enemy blood of the enemy starfall ticks -191034 9215716 30719 0.00 3031 6060 40.4 0.0 20.5% 0.0% 0.0% 0.0% 7.43sec 9215716 299.89sec
blood of the enemy blood of the enemy starsurge 78674 91593 305 0.24 62848 124682 1.4 1.2 19.6% 0.0% 0.0% 0.0% 264.55sec 91593 299.89sec
blood of the enemy blood of the enemy streaking_stars 272873 895473 2986 9.10 16384 32779 45.5 45.5 20.2% 0.0% 0.0% 0.0% 4.52sec 895473 299.89sec
blood of the enemy blood of the enemy sunfire 93402 98831 330 3.69 4445 8887 18.5 18.5 20.4% 0.0% 0.0% 0.0% 16.41sec 6049396 299.89sec
blood of the enemy blood of the enemy sunfire ticks -93402 5950565 19835 309.46 3191 6375 18.5 1547.3 20.6% 0.0% 0.0% 0.0% 16.41sec 6049396 299.89sec
crucible of flame crucible of flame ancient_flame ticks -295367 348651 1162 21.90 2680 5374 24.1 109.5 18.7% 0.0% 0.0% 0.0% 12.06sec 348651 299.89sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.97sec 0 299.89sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.75sec 0 299.89sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
crucible of flame crucible of flame fury_of_elune 202770 1753338 5847 178.36 1660 3314 5.3 891.5 18.6% 0.0% 0.0% 0.0% 61.13sec 1753338 299.89sec
crucible of flame crucible of flame heed_my_call 271685 86328 288 1.60 9131 18248 8.0 8.0 18.5% 0.0% 0.0% 0.0% 33.90sec 86328 299.89sec
crucible of flame crucible of flame heed_my_call_aoe 271686 259721 866 11.17 3913 7826 8.0 55.9 18.8% 0.0% 0.0% 0.0% 33.90sec 259721 299.89sec
crucible of flame crucible of flame lunar_strike 194153 3317917 11064 116.07 4816 9637 82.9 580.1 18.7% 0.0% 0.0% 0.0% 3.55sec 3317917 299.89sec
crucible of flame crucible of flame moonfire 8921 530058 1768 25.71 3476 6948 64.3 128.5 18.7% 0.0% 0.0% 0.0% 4.60sec 6318503 299.89sec
crucible of flame crucible of flame moonfire ticks -8921 5788445 19295 298.99 3263 6522 64.3 1495.0 18.7% 0.0% 0.0% 0.0% 4.60sec 6318503 299.89sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
crucible of flame crucible of flame solar_wrath 190984 349708 1166 6.51 9066 18123 31.7 32.5 18.5% 0.0% 0.0% 0.0% 8.98sec 349708 299.89sec
crucible of flame crucible of flame solar_empowerment 279729 913372 3046 24.40 7488 0 17.4 122.0 0.0% 0.0% 0.0% 0.0% 16.28sec 913372 299.89sec
crucible of flame crucible of flame starfall ticks -191034 8867617 29559 0.00 3031 6058 39.5 0.0 18.7% 0.0% 0.0% 0.0% 7.60sec 8867617 299.89sec
crucible of flame crucible of flame starsurge 78674 91147 304 0.24 62850 125393 1.4 1.2 19.1% 0.0% 0.0% 0.0% 264.79sec 91147 299.89sec
crucible of flame crucible of flame streaking_stars 272873 874406 2916 9.00 16376 32761 45.0 45.0 18.6% 0.0% 0.0% 0.0% 4.60sec 874406 299.89sec
crucible of flame crucible of flame sunfire 93402 97706 326 3.70 4441 8880 18.5 18.5 19.0% 0.0% 0.0% 0.0% 16.40sec 5803836 299.89sec
crucible of flame crucible of flame sunfire ticks -93402 5706129 19020 301.53 3189 6374 18.5 1507.7 18.7% 0.0% 0.0% 0.0% 16.40sec 5803836 299.89sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.92sec 0 299.89sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.71sec 0 299.89sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
focusing iris focusing iris fury_of_elune 202770 1806100 6023 183.55 1661 3315 5.3 917.4 18.6% 0.0% 0.0% 0.0% 60.89sec 1806100 299.89sec
focusing iris focusing iris heed_my_call 271685 89090 297 1.64 9127 18260 8.2 8.2 19.0% 0.0% 0.0% 0.0% 33.06sec 89090 299.89sec
focusing iris focusing iris heed_my_call_aoe 271686 266625 889 11.48 3912 7824 8.2 57.4 18.7% 0.0% 0.0% 0.0% 33.06sec 266625 299.89sec
focusing iris focusing iris lunar_strike 194153 3490288 11639 122.20 4817 9609 87.3 610.8 18.7% 0.0% 0.0% 0.0% 3.37sec 3490288 299.89sec
focusing iris focusing iris moonfire 8921 530184 1768 25.75 3471 6940 64.4 128.7 18.7% 0.0% 0.0% 0.0% 4.60sec 6518795 299.89sec
focusing iris focusing iris moonfire ticks -8921 5988611 19962 309.17 3264 6524 64.4 1545.9 18.7% 0.0% 0.0% 0.0% 4.60sec 6518795 299.89sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
focusing iris focusing iris solar_wrath 190984 359583 1199 6.69 9058 18124 32.6 33.4 18.7% 0.0% 0.0% 0.0% 8.77sec 359583 299.89sec
focusing iris focusing iris solar_empowerment 279729 956998 3191 25.54 7495 0 18.2 127.7 0.0% 0.0% 0.0% 0.0% 15.59sec 956998 299.89sec
focusing iris focusing iris starfall ticks -191034 9141642 30472 0.00 3032 6061 40.7 0.0 18.7% 0.0% 0.0% 0.0% 7.37sec 9141642 299.89sec
focusing iris focusing iris starsurge 78674 91789 306 0.25 62676 125771 1.4 1.2 19.0% 0.0% 0.0% 0.0% 268.97sec 91789 299.89sec
focusing iris focusing iris streaking_stars 272873 887032 2958 9.13 16388 32767 45.6 45.6 18.6% 0.0% 0.0% 0.0% 4.50sec 887032 299.89sec
focusing iris focusing iris sunfire 93402 96887 323 3.68 4442 8868 18.4 18.4 18.6% 0.0% 0.0% 0.0% 16.47sec 5999029 299.89sec
focusing iris focusing iris sunfire ticks -93402 5902142 19674 311.83 3190 6375 18.4 1559.2 18.7% 0.0% 0.0% 0.0% 16.47sec 5999029 299.89sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
life-force life-force azerite_spike 295835 252303 841 3.22 13216 26431 16.1 16.1 18.6% 0.0% 0.0% 0.0% 18.17sec 252303 299.89sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.09sec 0 299.89sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.87sec 0 299.89sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
life-force life-force fury_of_elune 202770 1757333 5860 178.37 1664 3324 5.3 891.5 18.5% 0.0% 0.0% 0.0% 61.16sec 1757333 299.89sec
life-force life-force heed_my_call 271685 85236 284 1.57 9166 18328 7.8 7.8 18.7% 0.0% 0.0% 0.0% 34.31sec 85236 299.89sec
life-force life-force heed_my_call_aoe 271686 255058 851 10.98 3921 7843 7.8 54.9 18.6% 0.0% 0.0% 0.0% 34.31sec 255058 299.89sec
life-force life-force lunar_strike 194153 3324128 11084 116.08 4830 9642 82.9 580.2 18.7% 0.0% 0.0% 0.0% 3.55sec 3324128 299.89sec
life-force life-force moonfire 8921 531454 1772 25.75 3484 6965 64.3 128.7 18.5% 0.0% 0.0% 0.0% 4.59sec 6332779 299.89sec
life-force life-force moonfire ticks -8921 5801325 19338 298.89 3270 6537 64.3 1494.5 18.7% 0.0% 0.0% 0.0% 4.59sec 6332779 299.89sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
life-force life-force solar_wrath 190984 349240 1165 6.47 9118 18223 31.5 32.4 18.4% 0.0% 0.0% 0.0% 9.01sec 349240 299.89sec
life-force life-force solar_empowerment 279729 905678 3020 24.14 7508 0 17.2 120.6 0.0% 0.0% 0.0% 0.0% 16.46sec 905678 299.89sec
life-force life-force starfall ticks -191034 8881364 29605 0.00 3038 6073 39.4 0.0 18.6% 0.0% 0.0% 0.0% 7.61sec 8881364 299.89sec
life-force life-force starsurge 78674 90919 303 0.25 63142 125896 1.4 1.2 17.5% 0.0% 0.0% 0.0% 269.21sec 90919 299.89sec
life-force life-force streaking_stars 272873 878085 2928 9.01 16472 32940 45.0 45.0 18.4% 0.0% 0.0% 0.0% 4.60sec 878085 299.89sec
life-force life-force sunfire 93402 98051 327 3.70 4461 8922 18.5 18.5 18.8% 0.0% 0.0% 0.0% 16.36sec 5815087 299.89sec
life-force life-force sunfire ticks -93402 5717035 19057 301.44 3196 6387 18.5 1507.2 18.7% 0.0% 0.0% 0.0% 16.36sec 5815087 299.89sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.20sec 0 299.89sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.98sec 0 299.89sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
lucid dreams lucid dreams fury_of_elune 202770 1778506 5931 179.31 1675 3343 5.3 896.2 18.6% 0.0% 0.0% 0.0% 60.95sec 1778506 299.89sec
lucid dreams lucid dreams heed_my_call 271685 87131 291 1.60 9187 18345 8.0 8.0 18.7% 0.0% 0.0% 0.0% 33.92sec 87131 299.89sec
lucid dreams lucid dreams heed_my_call_aoe 271686 261250 871 11.20 3936 7872 8.0 56.0 18.6% 0.0% 0.0% 0.0% 33.92sec 261250 299.89sec
lucid dreams lucid dreams lunar_strike 194153 3333394 11115 115.81 4850 9711 82.7 578.8 18.7% 0.0% 0.0% 0.0% 3.55sec 3333394 299.89sec
lucid dreams lucid dreams moonfire 8921 531681 1773 25.67 3494 6983 64.1 128.3 18.6% 0.0% 0.0% 0.0% 4.61sec 6385517 299.89sec
lucid dreams lucid dreams moonfire ticks -8921 5853836 19513 300.34 3286 6567 64.1 1501.7 18.7% 0.0% 0.0% 0.0% 4.61sec 6385517 299.89sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
lucid dreams lucid dreams solar_wrath 190984 345767 1153 6.40 9127 18246 31.1 32.0 18.4% 0.0% 0.0% 0.0% 9.15sec 345767 299.89sec
lucid dreams lucid dreams solar_empowerment 279729 908479 3029 24.16 7523 0 17.3 120.8 0.0% 0.0% 0.0% 0.0% 16.49sec 908479 299.89sec
lucid dreams lucid dreams starfall ticks -191034 9654332 32181 0.00 3065 6126 42.5 0.0 18.7% 0.0% 0.0% 0.0% 7.05sec 9654332 299.89sec
lucid dreams lucid dreams starsurge 78674 94622 316 0.26 61934 123593 1.5 1.3 19.0% 0.0% 0.0% 0.0% 184.78sec 94622 299.89sec
lucid dreams lucid dreams streaking_stars 272873 870482 2903 8.88 16557 33112 44.4 44.4 18.5% 0.0% 0.0% 0.0% 4.65sec 870482 299.89sec
lucid dreams lucid dreams sunfire 93402 95279 318 3.62 4456 8910 18.1 18.1 18.3% 0.0% 0.0% 0.0% 16.82sec 5875998 299.89sec
lucid dreams lucid dreams sunfire ticks -93402 5780719 19269 303.38 3212 6421 18.1 1516.9 18.7% 0.0% 0.0% 0.0% 16.82sec 5875998 299.89sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.09sec 0 299.89sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.86sec 0 299.89sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
purification protocol purification protocol fury_of_elune 202770 1752531 5844 178.25 1661 3315 5.3 890.9 18.5% 0.0% 0.0% 0.0% 61.16sec 1752531 299.89sec
purification protocol purification protocol heed_my_call 271685 85321 285 1.57 9124 18263 7.9 7.9 19.0% 0.0% 0.0% 0.0% 34.10sec 85321 299.89sec
purification protocol purification protocol heed_my_call_aoe 271686 255468 852 11.00 3910 7824 7.9 55.0 18.8% 0.0% 0.0% 0.0% 34.10sec 255468 299.89sec
purification protocol purification protocol lunar_strike 194153 3312096 11044 116.07 4813 9606 82.9 580.1 18.7% 0.0% 0.0% 0.0% 3.55sec 3312096 299.89sec
purification protocol purification protocol moonfire 8921 530516 1769 25.74 3475 6950 64.3 128.7 18.6% 0.0% 0.0% 0.0% 4.59sec 6317501 299.89sec
purification protocol purification protocol moonfire ticks -8921 5786986 19290 298.94 3264 6521 64.3 1494.7 18.7% 0.0% 0.0% 0.0% 4.59sec 6317501 299.89sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
purification protocol purification protocol purification_protocol 295293 1496437 4990 22.50 11226 22457 16.1 112.4 18.5% 0.0% 0.0% 0.0% 17.76sec 1496437 299.89sec
purification protocol purification protocol solar_wrath 190984 348411 1162 6.48 9072 18135 31.5 32.4 18.5% 0.0% 0.0% 0.0% 9.13sec 348411 299.89sec
purification protocol purification protocol solar_empowerment 279729 909354 3032 24.31 7486 0 17.4 121.5 0.0% 0.0% 0.0% 0.0% 16.61sec 909354 299.89sec
purification protocol purification protocol starfall ticks -191034 8861960 29540 0.00 3031 6059 39.5 0.0 18.6% 0.0% 0.0% 0.0% 7.62sec 8861960 299.89sec
purification protocol purification protocol starsurge 78674 91293 304 0.24 62827 125361 1.4 1.2 19.3% 0.0% 0.0% 0.0% 267.55sec 91293 299.89sec
purification protocol purification protocol streaking_stars 272873 872925 2911 9.00 16381 32758 45.0 45.0 18.5% 0.0% 0.0% 0.0% 4.61sec 872925 299.89sec
purification protocol purification protocol sunfire 93402 97386 325 3.70 4441 8882 18.5 18.5 18.6% 0.0% 0.0% 0.0% 16.38sec 5801552 299.89sec
purification protocol purification protocol sunfire ticks -93402 5704167 19014 301.48 3189 6374 18.5 1507.4 18.7% 0.0% 0.0% 0.0% 16.38sec 5801552 299.89sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.12sec 0 299.89sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.90sec 0 299.89sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
ripple in space ripple in space fury_of_elune 202770 1753958 5849 178.35 1660 3316 5.3 891.4 18.6% 0.0% 0.0% 0.0% 61.17sec 1753958 299.89sec
ripple in space ripple in space heed_my_call 271685 85176 284 1.57 9128 18263 7.9 7.9 18.7% 0.0% 0.0% 0.0% 34.83sec 85176 299.89sec
ripple in space ripple in space heed_my_call_aoe 271686 255397 852 11.00 3912 7825 7.9 55.0 18.7% 0.0% 0.0% 0.0% 34.83sec 255397 299.89sec
ripple in space ripple in space lunar_strike 194153 3313607 11049 116.03 4815 9617 82.8 579.9 18.7% 0.0% 0.0% 0.0% 3.56sec 3313607 299.89sec
ripple in space ripple in space moonfire 8921 530432 1769 25.75 3475 6948 64.3 128.7 18.6% 0.0% 0.0% 0.0% 4.59sec 6320235 299.89sec
ripple in space ripple in space moonfire ticks -8921 5789803 19299 298.97 3263 6522 64.3 1494.9 18.7% 0.0% 0.0% 0.0% 4.59sec 6320235 299.89sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
ripple in space ripple in space solar_wrath 190984 348687 1163 6.49 9069 18137 31.6 32.5 18.4% 0.0% 0.0% 0.0% 9.00sec 348687 299.89sec
ripple in space ripple in space solar_empowerment 279729 910310 3035 24.35 7480 0 17.4 121.7 0.0% 0.0% 0.0% 0.0% 16.35sec 910310 299.89sec
ripple in space ripple in space starfall ticks -191034 8865012 29550 0.00 3031 6059 39.5 0.0 18.7% 0.0% 0.0% 0.0% 7.61sec 8865012 299.89sec
ripple in space ripple in space starsurge 78674 91672 306 0.25 62682 125324 1.4 1.2 18.9% 0.0% 0.0% 0.0% 276.53sec 91672 299.89sec
ripple in space ripple in space streaking_stars 272873 875548 2920 9.01 16377 32772 45.0 45.0 18.7% 0.0% 0.0% 0.0% 4.59sec 875548 299.89sec
ripple in space ripple in space sunfire 93402 97370 325 3.70 4441 8883 18.5 18.5 18.5% 0.0% 0.0% 0.0% 16.39sec 5803448 299.89sec
ripple in space ripple in space sunfire ticks -93402 5706078 19020 301.50 3188 6375 18.5 1507.5 18.7% 0.0% 0.0% 0.0% 16.39sec 5803448 299.89sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.13sec 0 299.89sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.91sec 0 299.89sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
unbound force unbound force fury_of_elune 202770 1812404 6044 178.35 1663 3288 5.3 891.4 22.8% 0.0% 0.0% 0.0% 61.16sec 1812404 299.89sec
unbound force unbound force heed_my_call 271685 89064 297 1.59 9134 18253 8.0 8.0 22.5% 0.0% 0.0% 0.0% 34.39sec 89064 299.89sec
unbound force unbound force heed_my_call_aoe 271686 267435 892 11.15 3913 7831 8.0 55.8 22.5% 0.0% 0.0% 0.0% 34.39sec 267435 299.89sec
unbound force unbound force lunar_strike 194153 3414483 11386 116.16 4817 9587 82.9 580.6 22.3% 0.0% 0.0% 0.0% 3.55sec 3414483 299.89sec
unbound force unbound force moonfire 8921 546382 1822 25.73 3478 6935 64.3 128.6 22.3% 0.0% 0.0% 0.0% 4.60sec 6505292 299.89sec
unbound force unbound force moonfire ticks -8921 5958910 19863 298.98 3265 6508 64.3 1494.9 22.2% 0.0% 0.0% 0.0% 4.60sec 6505292 299.89sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
unbound force unbound force solar_wrath 190984 355771 1186 6.47 9077 18083 31.5 32.3 21.4% 0.0% 0.0% 0.0% 9.04sec 355771 299.89sec
unbound force unbound force solar_empowerment 279729 929056 3098 24.14 7700 0 17.2 120.7 0.0% 0.0% 0.0% 0.0% 16.52sec 929056 299.89sec
unbound force unbound force starfall ticks -191034 9131467 30438 0.00 3031 6052 39.5 0.0 22.3% 0.0% 0.0% 0.0% 7.61sec 9131467 299.89sec
unbound force unbound force starsurge 78674 92755 309 0.25 62792 124311 1.4 1.2 20.7% 0.0% 0.0% 0.0% 275.53sec 92755 299.89sec
unbound force unbound force streaking_stars 272873 888494 2963 9.00 16370 32760 45.0 45.0 20.6% 0.0% 0.0% 0.0% 4.60sec 888494 299.89sec
unbound force unbound force sunfire 93402 100276 334 3.70 4445 8861 18.5 18.5 22.0% 0.0% 0.0% 0.0% 16.36sec 5977140 299.89sec
unbound force unbound force sunfire ticks -93402 5876864 19590 301.52 3191 6358 18.5 1507.6 22.3% 0.0% 0.0% 0.0% 16.36sec 5977140 299.89sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
visions visions berserking 26297 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 296.72sec 0 299.89sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 148.12sec 0 299.89sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
visions visions fury_of_elune 202770 1579276 5266 155.05 1720 3437 4.4 775.0 18.5% 0.0% 0.0% 0.0% 71.98sec 1579276 299.89sec
visions visions heed_my_call 271685 85122 284 1.56 9229 18469 7.8 7.8 18.6% 0.0% 0.0% 0.0% 35.27sec 85122 299.89sec
visions visions heed_my_call_aoe 271686 255764 853 10.89 3956 7911 7.8 54.4 18.8% 0.0% 0.0% 0.0% 35.27sec 255764 299.89sec
visions visions lunar_strike 194153 3337790 11130 114.31 4924 9831 81.6 571.4 18.7% 0.0% 0.0% 0.0% 3.60sec 3337790 299.89sec
visions visions moonfire 8921 536390 1789 25.65 3525 7047 64.1 128.2 18.7% 0.0% 0.0% 0.0% 4.61sec 6406604 299.89sec
visions visions moonfire ticks -8921 5870214 19567 298.45 3314 6627 64.1 1492.2 18.7% 0.0% 0.0% 0.0% 4.61sec 6406604 299.89sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
visions visions solar_wrath 190984 377281 1258 6.94 9198 18408 33.9 34.7 18.2% 0.0% 0.0% 0.0% 8.46sec 377281 299.89sec
visions visions solar_empowerment 279729 925734 3087 24.39 7593 0 17.4 121.9 0.0% 0.0% 0.0% 0.0% 16.34sec 925734 299.89sec
visions visions starfall ticks -191034 8906196 29687 0.00 3077 6155 39.0 0.0 18.7% 0.0% 0.0% 0.0% 7.69sec 8906196 299.89sec
visions visions starsurge 78674 107417 358 0.28 63569 127783 1.6 1.4 18.7% 0.0% 0.0% 0.0% 218.20sec 107417 299.89sec
visions visions streaking_stars 272873 1054129 3515 10.76 16554 33105 53.8 53.8 18.4% 0.0% 0.0% 0.0% 4.39sec 1054129 299.89sec
visions visions sunfire 93402 98489 328 3.70 4502 9003 18.5 18.5 18.4% 0.0% 0.0% 0.0% 16.40sec 5887306 299.89sec
visions visions sunfire ticks -93402 5788818 19296 301.05 3240 6476 18.5 1505.2 18.7% 0.0% 0.0% 0.0% 16.40sec 5887306 299.89sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.19sec 0 299.89sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.97sec 0 299.89sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
worldvein worldvein fury_of_elune 202770 1870604 6238 178.41 1769 3535 5.3 891.7 18.6% 0.0% 0.0% 0.0% 61.18sec 1870604 299.89sec
worldvein worldvein heed_my_call 271685 85699 286 1.58 9128 18248 7.9 7.9 18.9% 0.0% 0.0% 0.0% 34.52sec 85699 299.89sec
worldvein worldvein heed_my_call_aoe 271686 256497 855 11.06 3912 7824 7.9 55.3 18.6% 0.0% 0.0% 0.0% 34.52sec 256497 299.89sec
worldvein worldvein lunar_strike 194153 3565543 11889 116.10 5177 10342 82.9 580.3 18.7% 0.0% 0.0% 0.0% 3.55sec 3565543 299.89sec
worldvein worldvein moonfire 8921 568931 1897 25.74 3725 7454 64.3 128.6 18.7% 0.0% 0.0% 0.0% 4.59sec 6787056 299.89sec
worldvein worldvein moonfire ticks -8921 6218125 20727 298.97 3504 7004 64.3 1494.8 18.7% 0.0% 0.0% 0.0% 4.59sec 6787056 299.89sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.89sec
worldvein worldvein solar_wrath 190984 371950 1240 6.49 9690 19399 31.5 32.4 18.4% 0.0% 0.0% 0.0% 8.99sec 371950 299.89sec
worldvein worldvein solar_empowerment 279729 977868 3261 24.35 8034 0 17.4 121.7 0.0% 0.0% 0.0% 0.0% 16.23sec 977868 299.89sec
worldvein worldvein starfall ticks -191034 9517461 31725 0.00 3254 6507 39.5 0.0 18.7% 0.0% 0.0% 0.0% 7.61sec 9517461 299.89sec
worldvein worldvein starsurge 78674 96765 323 0.25 66301 132943 1.4 1.2 18.3% 0.0% 0.0% 0.0% 265.66sec 96765 299.89sec
worldvein worldvein streaking_stars 272873 873793 2914 9.00 16390 32789 45.0 45.0 18.5% 0.0% 0.0% 0.0% 4.61sec 873793 299.89sec
worldvein worldvein sunfire 93402 104333 348 3.70 4755 9508 18.5 18.5 18.6% 0.0% 0.0% 0.0% 16.37sec 6227666 299.89sec
worldvein worldvein sunfire ticks -93402 6123333 20411 301.51 3422 6843 18.5 1507.5 18.7% 0.0% 0.0% 0.0% 16.37sec 6227666 299.89sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
206462.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 8.94% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:8.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.69% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 13.28% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:13.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 13.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:13.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 3.7 0.4 57.5sec 50.8sec 7.83% 0.00% 0.4(0.4) 3.7

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:7.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 206462.21
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 2851
Mean 220191.05
Minimum 207919.54
Maximum 237170.21
Spread ( max - min ) 29250.66
Range [ ( max - min ) / 2 * 100% ] 6.64%
Standard Deviation 5980.6362
5th Percentile 211423.81
95th Percentile 229963.86
( 95th Percentile - 5th Percentile ) 18540.05
Mean Distribution
Standard Deviation 112.0079
95.00% Confidence Intervall ( 219971.52 - 220410.58 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2834
0.1 Scale Factor Error with Delta=300 305337
0.05 Scale Factor Error with Delta=300 1221346
0.01 Scale Factor Error with Delta=300 30533630
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 73993877 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133896.6 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.49% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.71%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 2.5 0.2 62.1sec 55.8sec 5.26% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:5.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 133896.63
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy2 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 2851
Mean 143769.30
Minimum 138806.83
Maximum 149428.09
Spread ( max - min ) 10621.27
Range [ ( max - min ) / 2 * 100% ] 3.69%
Standard Deviation 1946.7427
5th Percentile 140699.27
95th Percentile 146909.85
( 95th Percentile - 5th Percentile ) 6210.57
Mean Distribution
Standard Deviation 36.4594
95.00% Confidence Intervall ( 143697.84 - 143840.76 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 705
0.1 Scale Factor Error with Delta=300 32352
0.05 Scale Factor Error with Delta=300 129408
0.01 Scale Factor Error with Delta=300 3235198
HPS
Sample Data enemy2 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy2 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 45715206 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133571.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.16% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.34% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.69% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 1.9 0.1 66.3sec 59.8sec 3.79% 0.00% 0.1(0.1) 1.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:3.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy3
Resource RPS-Gain RPS-Loss
Health 0.00 133571.54
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy3 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy3 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy3 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy3 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy3 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy3 Damage Taken Per Second
Count 2851
Mean 143385.79
Minimum 138119.40
Maximum 148648.66
Spread ( max - min ) 10529.26
Range [ ( max - min ) / 2 * 100% ] 3.67%
Standard Deviation 1907.4491
5th Percentile 140399.07
95th Percentile 146423.66
( 95th Percentile - 5th Percentile ) 6024.59
Mean Distribution
Standard Deviation 35.7235
95.00% Confidence Intervall ( 143315.77 - 143455.81 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 680
0.1 Scale Factor Error with Delta=300 31060
0.05 Scale Factor Error with Delta=300 124237
0.01 Scale Factor Error with Delta=300 3105916
HPS
Sample Data enemy3 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy3 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy3 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy3 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy3 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy3Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy3 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 40972113 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133765.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 12.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.87% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.74% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.74%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.20% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.67% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 1.5 0.1 65.3sec 58.9sec 2.99% 0.00% 0.1(0.1) 1.4

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:2.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy4
Resource RPS-Gain RPS-Loss
Health 0.00 133765.80
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy4 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy4 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy4 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy4 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy4 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy4 Damage Taken Per Second
Count 2851
Mean 143155.62
Minimum 137439.33
Maximum 148778.80
Spread ( max - min ) 11339.47
Range [ ( max - min ) / 2 * 100% ] 3.96%
Standard Deviation 1895.3568
5th Percentile 140230.49
95th Percentile 146224.23
( 95th Percentile - 5th Percentile ) 5993.74
Mean Distribution
Standard Deviation 35.4971
95.00% Confidence Intervall ( 143086.05 - 143225.20 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 674
0.1 Scale Factor Error with Delta=300 30667
0.05 Scale Factor Error with Delta=300 122667
0.01 Scale Factor Error with Delta=300 3066660
HPS
Sample Data enemy4 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy4 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy4 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy4 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy4 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy4Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy4 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 45286438 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133469.7 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 12.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.34% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.72% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.68% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 1.1 0.1 60.1sec 54.9sec 2.31% 0.00% 0.1(0.1) 1.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:2.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy5
Resource RPS-Gain RPS-Loss
Health 0.00 133469.67
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy5 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy5 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy5 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy5 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy5 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy5 Damage Taken Per Second
Count 2851
Mean 142961.12
Minimum 137542.29
Maximum 147618.39
Spread ( max - min ) 10076.10
Range [ ( max - min ) / 2 * 100% ] 3.52%
Standard Deviation 1892.5688
5th Percentile 139978.25
95th Percentile 146025.98
( 95th Percentile - 5th Percentile ) 6047.73
Mean Distribution
Standard Deviation 35.4448
95.00% Confidence Intervall ( 142891.64 - 143030.59 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 674
0.1 Scale Factor Error with Delta=300 30577
0.05 Scale Factor Error with Delta=300 122306
0.01 Scale Factor Error with Delta=300 3057645
HPS
Sample Data enemy5 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy5 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy5 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy5 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy5 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy5Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy5 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 40062364 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy6 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
132867.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.31% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.13%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.15% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.67% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 1.1 0.1 59.7sec 53.8sec 2.15% 0.00% 0.1(0.1) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:2.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy6
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy6
Resource RPS-Gain RPS-Loss
Health 0.00 132867.84
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy6 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy6 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy6 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy6 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy6 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy6 Damage Taken Per Second
Count 2851
Mean 142833.82
Minimum 136940.32
Maximum 148083.87
Spread ( max - min ) 11143.54
Range [ ( max - min ) / 2 * 100% ] 3.90%
Standard Deviation 1888.8514
5th Percentile 139918.51
95th Percentile 145821.47
( 95th Percentile - 5th Percentile ) 5902.97
Mean Distribution
Standard Deviation 35.3752
95.00% Confidence Intervall ( 142764.48 - 142903.15 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 672
0.1 Scale Factor Error with Delta=300 30457
0.05 Scale Factor Error with Delta=300 121826
0.01 Scale Factor Error with Delta=300 3045645
HPS
Sample Data enemy6 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy6 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy6 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy6 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy6 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy6Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy6 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 38924199 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy6"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy7 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
133816.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 12.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.30% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.75% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.49% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.73% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.21% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Condensed Life-Force (condensed_life_force) 3.2 0.3 61.8sec 54.8sec 6.50% 0.00% 0.3(0.3) 3.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:6.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:enemy7
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy7
Resource RPS-Gain RPS-Loss
Health 0.00 133816.55
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data enemy7 Fight Length
Count 2851
Mean 299.89
Minimum 240.06
Maximum 360.00
Spread ( max - min ) 119.93
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data enemy7 Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy7 Priority Target Damage Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy7 Damage Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy7 Damage
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy7 Damage Taken Per Second
Count 2851
Mean 143566.49
Minimum 138446.07
Maximum 148558.11
Spread ( max - min ) 10112.04
Range [ ( max - min ) / 2 * 100% ] 3.52%
Standard Deviation 1893.4210
5th Percentile 140628.49
95th Percentile 146658.60
( 95th Percentile - 5th Percentile ) 6030.11
Mean Distribution
Standard Deviation 35.4608
95.00% Confidence Intervall ( 143496.99 - 143636.00 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 669
0.1 Scale Factor Error with Delta=300 30604
0.05 Scale Factor Error with Delta=300 122416
0.01 Scale Factor Error with Delta=300 3060400
HPS
Sample Data enemy7 Healing Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy7 Healing Per Second (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy7 Heal
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy7 Healing Taken Per Second
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy7 Theck-Meloree Index
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy7Theck-Meloree Index (Effective)
Count 2851
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy7 Max Spike Value
Count 600
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 39403670 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy7"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n